Use abstract filesystem for stores

This commit is contained in:
Ingo Oppermann 2023-02-01 16:09:20 +01:00
parent 49b16f44a8
commit 2a3288ffd0
No known key found for this signature in database
GPG key ID: 2AB32426E9DD229E
316 changed files with 13512 additions and 17601 deletions

View file

@ -34,7 +34,7 @@ import (
"github.com/datarhei/core/v16/restream" "github.com/datarhei/core/v16/restream"
restreamapp "github.com/datarhei/core/v16/restream/app" restreamapp "github.com/datarhei/core/v16/restream/app"
"github.com/datarhei/core/v16/restream/replace" "github.com/datarhei/core/v16/restream/replace"
"github.com/datarhei/core/v16/restream/store" restreamstore "github.com/datarhei/core/v16/restream/store"
"github.com/datarhei/core/v16/rtmp" "github.com/datarhei/core/v16/rtmp"
"github.com/datarhei/core/v16/service" "github.com/datarhei/core/v16/service"
"github.com/datarhei/core/v16/session" "github.com/datarhei/core/v16/session"
@ -153,7 +153,8 @@ func (a *api) Reload() error {
logger := log.New("Core").WithOutput(log.NewConsoleWriter(a.log.writer, log.Lwarn, true)) logger := log.New("Core").WithOutput(log.NewConsoleWriter(a.log.writer, log.Lwarn, true))
store, err := configstore.NewJSON(a.config.path, func() { rootfs, _ := fs.NewDiskFilesystem(fs.DiskConfig{})
store, err := configstore.NewJSON(rootfs, a.config.path, func() {
a.errorChan <- ErrConfigReload a.errorChan <- ErrConfigReload
}) })
if err != nil { if err != nil {
@ -295,7 +296,13 @@ func (a *api) start() error {
} }
if cfg.Sessions.Persist { if cfg.Sessions.Persist {
sessionConfig.PersistDir = filepath.Join(cfg.DB.Dir, "sessions") fs, err := fs.NewRootedDiskFilesystem(fs.RootedDiskConfig{
Root: filepath.Join(cfg.DB.Dir, "sessions"),
})
if err != nil {
return fmt.Errorf("unable to create filesystem for persisting sessions: %w", err)
}
sessionConfig.PersistFS = fs
} }
sessions, err := session.New(sessionConfig) sessions, err := session.New(sessionConfig)
@ -374,11 +381,9 @@ func (a *api) start() error {
a.sessions = sessions a.sessions = sessions
} }
diskfs, err := fs.NewDiskFilesystem(fs.DiskConfig{ diskfs, err := fs.NewRootedDiskFilesystem(fs.RootedDiskConfig{
Name: "disk", Root: cfg.Storage.Disk.Dir,
Dir: cfg.Storage.Disk.Dir, Logger: a.log.logger.core.WithComponent("DiskFS"),
Size: cfg.Storage.Disk.Size * 1024 * 1024,
Logger: a.log.logger.core.WithComponent("FS"),
}) })
if err != nil { if err != nil {
return fmt.Errorf("disk filesystem: %w", err) return fmt.Errorf("disk filesystem: %w", err)
@ -403,21 +408,27 @@ func (a *api) start() error {
} }
if a.memfs == nil { if a.memfs == nil {
memfs := fs.NewMemFilesystem(fs.MemConfig{ memfs, _ := fs.NewMemFilesystem(fs.MemConfig{
Name: "mem", Logger: a.log.logger.core.WithComponent("MemFS"),
Base: baseMemFS.String(),
Size: cfg.Storage.Memory.Size * 1024 * 1024,
Purge: cfg.Storage.Memory.Purge,
Logger: a.log.logger.core.WithComponent("FS"),
}) })
a.memfs = memfs memfs.SetMetadata("base", baseMemFS.String())
sizedfs, _ := fs.NewSizedFilesystem(memfs, cfg.Storage.Memory.Size*1024*1024, cfg.Storage.Memory.Purge)
a.memfs = sizedfs
} else { } else {
a.memfs.Rebase(baseMemFS.String()) a.memfs.SetMetadata("base", baseMemFS.String())
a.memfs.Resize(cfg.Storage.Memory.Size * 1024 * 1024) if sizedfs, ok := a.memfs.(fs.SizedFilesystem); ok {
sizedfs.Resize(cfg.Storage.Memory.Size * 1024 * 1024)
}
} }
for _, s3 := range cfg.Storage.S3 { for _, s3 := range cfg.Storage.S3 {
if _, ok := a.s3fs[s3.Name]; ok {
return fmt.Errorf("the name '%s' for a s3 filesystem is already in use", s3.Name)
}
baseS3FS := url.URL{ baseS3FS := url.URL{
Scheme: "http", Scheme: "http",
Path: s3.Mountpoint, Path: s3.Mountpoint,
@ -436,7 +447,6 @@ func (a *api) start() error {
s3fs, err := fs.NewS3Filesystem(fs.S3Config{ s3fs, err := fs.NewS3Filesystem(fs.S3Config{
Name: s3.Name, Name: s3.Name,
Base: baseS3FS.String(),
Endpoint: s3.Endpoint, Endpoint: s3.Endpoint,
AccessKeyID: s3.AccessKeyID, AccessKeyID: s3.AccessKeyID,
SecretAccessKey: s3.SecretAccessKey, SecretAccessKey: s3.SecretAccessKey,
@ -449,9 +459,7 @@ func (a *api) start() error {
return fmt.Errorf("s3 filesystem (%s): %w", s3.Name, err) return fmt.Errorf("s3 filesystem (%s): %w", s3.Name, err)
} }
if _, ok := a.s3fs[s3.Name]; ok { s3fs.SetMetadata("base", baseS3FS.String())
return fmt.Errorf("the name '%s' for a filesystem is already in use", s3.Name)
}
a.s3fs[s3.Name] = s3fs a.s3fs[s3.Name] = s3fs
} }
@ -495,23 +503,23 @@ func (a *api) start() error {
{ {
a.replacer.RegisterTemplateFunc("diskfs", func(config *restreamapp.Config, section string) string { a.replacer.RegisterTemplateFunc("diskfs", func(config *restreamapp.Config, section string) string {
return a.diskfs.Base() return a.diskfs.Metadata("base")
}, nil) }, nil)
a.replacer.RegisterTemplateFunc("fs:disk", func(config *restreamapp.Config, section string) string { a.replacer.RegisterTemplateFunc("fs:disk", func(config *restreamapp.Config, section string) string {
return a.diskfs.Base() return a.diskfs.Metadata("base")
}, nil) }, nil)
a.replacer.RegisterTemplateFunc("memfs", func(config *restreamapp.Config, section string) string { a.replacer.RegisterTemplateFunc("memfs", func(config *restreamapp.Config, section string) string {
return a.memfs.Base() return a.memfs.Metadata("base")
}, nil) }, nil)
a.replacer.RegisterTemplateFunc("fs:mem", func(config *restreamapp.Config, section string) string { a.replacer.RegisterTemplateFunc("fs:mem", func(config *restreamapp.Config, section string) string {
return a.memfs.Base() return a.memfs.Metadata("base")
}, nil) }, nil)
for name, s3 := range a.s3fs { for name, s3 := range a.s3fs {
a.replacer.RegisterTemplate("fs:"+name, s3.Base(), nil) a.replacer.RegisterTemplate("fs:"+name, s3.Metadata("base"), nil)
} }
a.replacer.RegisterTemplateFunc("rtmp", func(config *restreamapp.Config, section string) string { a.replacer.RegisterTemplateFunc("rtmp", func(config *restreamapp.Config, section string) string {
@ -567,11 +575,24 @@ func (a *api) start() error {
filesystems = append(filesystems, fs) filesystems = append(filesystems, fs)
} }
store := store.NewJSONStore(store.JSONConfig{ var store restreamstore.Store = nil
Filepath: cfg.DB.Dir + "/db.json",
FFVersion: a.ffmpeg.Skills().FFmpeg.Version, {
fs, err := fs.NewRootedDiskFilesystem(fs.RootedDiskConfig{
Root: cfg.DB.Dir,
})
if err != nil {
return err
}
store, err = restreamstore.NewJSON(restreamstore.JSONConfig{
Filesystem: fs,
Filepath: "/db.json",
Logger: a.log.logger.core.WithComponent("ProcessStore"), Logger: a.log.logger.core.WithComponent("ProcessStore"),
}) })
if err != nil {
return err
}
}
restream, err := restream.New(restream.Config{ restream, err := restream.New(restream.Config{
ID: cfg.ID, ID: cfg.ID,
@ -645,8 +666,8 @@ func (a *api) start() error {
metrics.Register(monitor.NewCPUCollector()) metrics.Register(monitor.NewCPUCollector())
metrics.Register(monitor.NewMemCollector()) metrics.Register(monitor.NewMemCollector())
metrics.Register(monitor.NewNetCollector()) metrics.Register(monitor.NewNetCollector())
metrics.Register(monitor.NewDiskCollector(a.diskfs.Base())) metrics.Register(monitor.NewDiskCollector(a.diskfs.Metadata("base")))
metrics.Register(monitor.NewFilesystemCollector("diskfs", diskfs)) metrics.Register(monitor.NewFilesystemCollector("diskfs", a.diskfs))
metrics.Register(monitor.NewFilesystemCollector("memfs", a.memfs)) metrics.Register(monitor.NewFilesystemCollector("memfs", a.memfs))
for name, fs := range a.s3fs { for name, fs := range a.s3fs {
metrics.Register(monitor.NewFilesystemCollector(name, fs)) metrics.Register(monitor.NewFilesystemCollector(name, fs))
@ -1395,7 +1416,7 @@ func (a *api) Destroy() {
// Free the MemFS // Free the MemFS
if a.memfs != nil { if a.memfs != nil {
a.memfs.DeleteAll() a.memfs.RemoveAll()
a.memfs = nil a.memfs = nil
} }
} }

View file

@ -9,6 +9,7 @@ import (
cfgvars "github.com/datarhei/core/v16/config/vars" cfgvars "github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/ffmpeg" "github.com/datarhei/core/v16/ffmpeg"
"github.com/datarhei/core/v16/io/file" "github.com/datarhei/core/v16/io/file"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
"github.com/datarhei/core/v16/restream/store" "github.com/datarhei/core/v16/restream/store"
@ -24,7 +25,9 @@ func main() {
configfile := cfgstore.Location(os.Getenv("CORE_CONFIGFILE")) configfile := cfgstore.Location(os.Getenv("CORE_CONFIGFILE"))
configstore, err := cfgstore.NewJSON(configfile, nil) diskfs, _ := fs.NewDiskFilesystem(fs.DiskConfig{})
configstore, err := cfgstore.NewJSON(diskfs, configfile, nil)
if err != nil { if err != nil {
logger.Error().WithError(err).Log("Loading configuration failed") logger.Error().WithError(err).Log("Loading configuration failed")
os.Exit(1) os.Exit(1)
@ -117,9 +120,12 @@ func doMigration(logger log.Logger, configstore cfgstore.Store) error {
logger.Info().WithField("backup", backupFilepath).Log("Backup created") logger.Info().WithField("backup", backupFilepath).Log("Backup created")
// Load the existing DB // Load the existing DB
datastore := store.NewJSONStore(store.JSONConfig{ datastore, err := store.NewJSON(store.JSONConfig{
Filepath: cfg.DB.Dir + "/db.json", Filepath: cfg.DB.Dir + "/db.json",
}) })
if err != nil {
return err
}
data, err := datastore.Load() data, err := datastore.Load()
if err != nil { if err != nil {

View file

@ -17,6 +17,7 @@ import (
"github.com/datarhei/core/v16/encoding/json" "github.com/datarhei/core/v16/encoding/json"
"github.com/datarhei/core/v16/ffmpeg" "github.com/datarhei/core/v16/ffmpeg"
"github.com/datarhei/core/v16/ffmpeg/skills" "github.com/datarhei/core/v16/ffmpeg/skills"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/restream" "github.com/datarhei/core/v16/restream"
"github.com/datarhei/core/v16/restream/app" "github.com/datarhei/core/v16/restream/app"
"github.com/datarhei/core/v16/restream/store" "github.com/datarhei/core/v16/restream/store"
@ -495,14 +496,14 @@ type importConfigAudio struct {
sampling string sampling string
} }
func importV1(path string, cfg importConfig) (store.StoreData, error) { func importV1(fs fs.Filesystem, path string, cfg importConfig) (store.StoreData, error) {
if len(cfg.id) == 0 { if len(cfg.id) == 0 {
cfg.id = uuid.New().String() cfg.id = uuid.New().String()
} }
r := store.NewStoreData() r := store.NewStoreData()
jsondata, err := os.ReadFile(path) jsondata, err := fs.ReadFile(path)
if err != nil { if err != nil {
return r, fmt.Errorf("failed to read data from %s: %w", path, err) return r, fmt.Errorf("failed to read data from %s: %w", path, err)
} }
@ -1417,9 +1418,19 @@ func probeInput(binary string, config app.Config) app.Probe {
return app.Probe{} return app.Probe{}
} }
dummyfs, _ := fs.NewMemFilesystem(fs.MemConfig{})
store, err := store.NewJSON(store.JSONConfig{
Filesystem: dummyfs,
Filepath: "/",
Logger: nil,
})
if err != nil {
return app.Probe{}
}
rs, err := restream.New(restream.Config{ rs, err := restream.New(restream.Config{
FFmpeg: ffmpeg, FFmpeg: ffmpeg,
Store: store.NewDummyStore(store.DummyConfig{}), Store: store,
}) })
if err != nil { if err != nil {
return app.Probe{} return app.Probe{}

View file

@ -6,6 +6,7 @@ import (
"testing" "testing"
"github.com/datarhei/core/v16/encoding/json" "github.com/datarhei/core/v16/encoding/json"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/restream/store" "github.com/datarhei/core/v16/restream/store"
"github.com/stretchr/testify/require" "github.com/stretchr/testify/require"
@ -36,8 +37,13 @@ import (
var id string = "4186b095-7f0a-4e94-8c3d-f17459ab252f" var id string = "4186b095-7f0a-4e94-8c3d-f17459ab252f"
func testV1Import(t *testing.T, v1Fixture, v4Fixture string, config importConfig) { func testV1Import(t *testing.T, v1Fixture, v4Fixture string, config importConfig) {
diskfs, err := fs.NewRootedDiskFilesystem(fs.RootedDiskConfig{
Root: ".",
})
require.NoError(t, err)
// Import v1 database // Import v1 database
v4, err := importV1(v1Fixture, config) v4, err := importV1(diskfs, v1Fixture, config)
require.Equal(t, nil, err) require.Equal(t, nil, err)
// Reset variants // Reset variants
@ -50,7 +56,7 @@ func testV1Import(t *testing.T, v1Fixture, v4Fixture string, config importConfig
require.Equal(t, nil, err) require.Equal(t, nil, err)
// Read the wanted result // Read the wanted result
wantdatav4, err := os.ReadFile(v4Fixture) wantdatav4, err := diskfs.ReadFile(v4Fixture)
require.Equal(t, nil, err) require.Equal(t, nil, err)
var wantv4 store.StoreData var wantv4 store.StoreData

View file

@ -6,6 +6,7 @@ import (
cfgstore "github.com/datarhei/core/v16/config/store" cfgstore "github.com/datarhei/core/v16/config/store"
cfgvars "github.com/datarhei/core/v16/config/vars" cfgvars "github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
"github.com/datarhei/core/v16/restream/store" "github.com/datarhei/core/v16/restream/store"
@ -17,18 +18,24 @@ func main() {
configfile := cfgstore.Location(os.Getenv("CORE_CONFIGFILE")) configfile := cfgstore.Location(os.Getenv("CORE_CONFIGFILE"))
configstore, err := cfgstore.NewJSON(configfile, nil) diskfs, err := fs.NewDiskFilesystem(fs.DiskConfig{})
if err != nil {
logger.Error().WithError(err).Log("Access disk filesystem failed")
os.Exit(1)
}
configstore, err := cfgstore.NewJSON(diskfs, configfile, nil)
if err != nil { if err != nil {
logger.Error().WithError(err).Log("Loading configuration failed") logger.Error().WithError(err).Log("Loading configuration failed")
os.Exit(1) os.Exit(1)
} }
if err := doImport(logger, configstore); err != nil { if err := doImport(logger, diskfs, configstore); err != nil {
os.Exit(1) os.Exit(1)
} }
} }
func doImport(logger log.Logger, configstore cfgstore.Store) error { func doImport(logger log.Logger, fs fs.Filesystem, configstore cfgstore.Store) error {
if logger == nil { if logger == nil {
logger = log.New("") logger = log.New("")
} }
@ -67,23 +74,27 @@ func doImport(logger log.Logger, configstore cfgstore.Store) error {
logger = logger.WithField("database", v1filename) logger = logger.WithField("database", v1filename)
if _, err := os.Stat(v1filename); err != nil { if _, err := fs.Stat(v1filename); err != nil {
if os.IsNotExist(err) { if os.IsNotExist(err) {
logger.Info().Log("Database doesn't exist and nothing will be imported") logger.Info().Log("Database doesn't exist and nothing will be imported")
return nil return nil
} }
logger.Error().WithError(err).Log("Checking for v1 database") logger.Error().WithError(err).Log("Checking for v1 database")
return fmt.Errorf("checking for v1 database: %w", err) return fmt.Errorf("checking for v1 database: %w", err)
} }
logger.Info().Log("Found database") logger.Info().Log("Found database")
// Load an existing DB // Load an existing DB
datastore := store.NewJSONStore(store.JSONConfig{ datastore, err := store.NewJSON(store.JSONConfig{
Filesystem: fs,
Filepath: cfg.DB.Dir + "/db.json", Filepath: cfg.DB.Dir + "/db.json",
}) })
if err != nil {
logger.Error().WithError(err).Log("Creating datastore for new database failed")
return fmt.Errorf("creating datastore for new database failed: %w", err)
}
data, err := datastore.Load() data, err := datastore.Load()
if err != nil { if err != nil {
@ -105,7 +116,7 @@ func doImport(logger log.Logger, configstore cfgstore.Store) error {
importConfig.binary = cfg.FFmpeg.Binary importConfig.binary = cfg.FFmpeg.Binary
// Rewrite the old database to the new database // Rewrite the old database to the new database
r, err := importV1(v1filename, importConfig) r, err := importV1(fs, v1filename, importConfig)
if err != nil { if err != nil {
logger.Error().WithError(err).Log("Importing database failed") logger.Error().WithError(err).Log("Importing database failed")
return fmt.Errorf("importing database failed: %w", err) return fmt.Errorf("importing database failed: %w", err)

View file

@ -1,20 +1,29 @@
package main package main
import ( import (
"strings"
"testing" "testing"
"github.com/datarhei/core/v16/config/store" "github.com/datarhei/core/v16/config/store"
"github.com/datarhei/core/v16/io/fs"
"github.com/stretchr/testify/require" "github.com/stretchr/testify/require"
) )
func TestImport(t *testing.T) { func TestImport(t *testing.T) {
configstore := store.NewDummy() memfs, err := fs.NewMemFilesystem(fs.MemConfig{})
require.NoError(t, err)
memfs.WriteFileReader("/mime.types", strings.NewReader("foobar"))
configstore, err := store.NewJSON(memfs, "/config.json", nil)
require.NoError(t, err)
cfg := configstore.Get() cfg := configstore.Get()
err := configstore.Set(cfg) err = configstore.Set(cfg)
require.NoError(t, err) require.NoError(t, err)
err = doImport(nil, configstore) err = doImport(nil, memfs, configstore)
require.NoError(t, err) require.NoError(t, err)
} }

View file

@ -9,6 +9,7 @@ import (
"github.com/datarhei/core/v16/config/copy" "github.com/datarhei/core/v16/config/copy"
"github.com/datarhei/core/v16/config/value" "github.com/datarhei/core/v16/config/value"
"github.com/datarhei/core/v16/config/vars" "github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/math/rand" "github.com/datarhei/core/v16/math/rand"
haikunator "github.com/atrox/haikunatorgo/v2" haikunator "github.com/atrox/haikunatorgo/v2"
@ -46,14 +47,21 @@ const version int64 = 3
// Config is a wrapper for Data // Config is a wrapper for Data
type Config struct { type Config struct {
fs fs.Filesystem
vars vars.Variables vars vars.Variables
Data Data
} }
// New returns a Config which is initialized with its default values // New returns a Config which is initialized with its default values
func New() *Config { func New(f fs.Filesystem) *Config {
config := &Config{} config := &Config{
fs: f,
}
if config.fs == nil {
config.fs, _ = fs.NewMemFilesystem(fs.MemConfig{})
}
config.init() config.init()
@ -70,7 +78,7 @@ func (d *Config) Set(name, val string) error {
// NewConfigFrom returns a clone of a Config // NewConfigFrom returns a clone of a Config
func (d *Config) Clone() *Config { func (d *Config) Clone() *Config {
data := New() data := New(d.fs)
data.CreatedAt = d.CreatedAt data.CreatedAt = d.CreatedAt
data.LoadedAt = d.LoadedAt data.LoadedAt = d.LoadedAt
@ -145,7 +153,7 @@ func (d *Config) init() {
d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false) d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false)
// DB // DB
d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config"), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false) d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config", d.fs), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false)
// Host // Host
d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false) d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false)
@ -174,14 +182,14 @@ func (d *Config) init() {
d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false) d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false)
d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false) d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false)
d.vars.Register(value.NewEmail(&d.TLS.Email, "cert@datarhei.com"), "tls.email", "CORE_TLS_EMAIL", nil, "Email for Let's Encrypt registration", false, false) d.vars.Register(value.NewEmail(&d.TLS.Email, "cert@datarhei.com"), "tls.email", "CORE_TLS_EMAIL", nil, "Email for Let's Encrypt registration", false, false)
d.vars.Register(value.NewFile(&d.TLS.CertFile, ""), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.CertFile, "", d.fs), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false)
d.vars.Register(value.NewFile(&d.TLS.KeyFile, ""), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.KeyFile, "", d.fs), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false)
// Storage // Storage
d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types"), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false) d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types", d.fs), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false)
// Storage (Disk) // Storage (Disk)
d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data"), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false) d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data", d.fs), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false)
d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false) d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false)
d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false) d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false)
d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false) d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false)
@ -262,7 +270,7 @@ func (d *Config) init() {
// Router // Router
d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false) d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false)
d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false) d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false)
d.vars.Register(value.NewDir(&d.Router.UIPath, ""), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false) d.vars.Register(value.NewDir(&d.Router.UIPath, "", d.fs), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false)
} }
// Validate validates the current state of the Config for completeness and sanity. Errors are // Validate validates the current state of the Config for completeness and sanity. Errors are

View file

@ -1,13 +1,18 @@
package config package config
import ( import (
"strings"
"testing" "testing"
"github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/io/fs"
"github.com/stretchr/testify/require" "github.com/stretchr/testify/require"
) )
func TestConfigCopy(t *testing.T) { func TestConfigCopy(t *testing.T) {
config1 := New() fs, _ := fs.NewMemFilesystem(fs.MemConfig{})
config1 := New(fs)
config1.Version = 42 config1.Version = 42
config1.DB.Dir = "foo" config1.DB.Dir = "foo"
@ -50,3 +55,25 @@ func TestConfigCopy(t *testing.T) {
require.Equal(t, []string{"bar.com"}, config1.Host.Name) require.Equal(t, []string{"bar.com"}, config1.Host.Name)
require.Equal(t, []string{"foo.com"}, config2.Host.Name) require.Equal(t, []string{"foo.com"}, config2.Host.Name)
} }
func TestValidateDefault(t *testing.T) {
fs, _ := fs.NewMemFilesystem(fs.MemConfig{})
size, fresh, err := fs.WriteFileReader("./mime.types", strings.NewReader("xxxxx"))
require.Equal(t, int64(5), size)
require.Equal(t, true, fresh)
require.NoError(t, err)
cfg := New(fs)
cfg.Validate(true)
errors := []string{}
cfg.Messages(func(level string, v vars.Variable, message string) {
if level == "error" {
errors = append(errors, message)
}
})
require.Equal(t, 0, len(cfg.Overrides()))
require.Equal(t, false, cfg.HasErrors(), errors)
}

View file

@ -6,6 +6,7 @@ import (
"github.com/datarhei/core/v16/config/copy" "github.com/datarhei/core/v16/config/copy"
v2 "github.com/datarhei/core/v16/config/v2" v2 "github.com/datarhei/core/v16/config/v2"
"github.com/datarhei/core/v16/config/value" "github.com/datarhei/core/v16/config/value"
"github.com/datarhei/core/v16/io/fs"
) )
// Data is the actual configuration data for the app // Data is the actual configuration data for the app
@ -167,8 +168,8 @@ type Data struct {
} `json:"router"` } `json:"router"`
} }
func UpgradeV2ToV3(d *v2.Data) (*Data, error) { func UpgradeV2ToV3(d *v2.Data, fs fs.Filesystem) (*Data, error) {
cfg := New() cfg := New(fs)
return MergeV2toV3(&cfg.Data, d) return MergeV2toV3(&cfg.Data, d)
} }

36
config/data_test.go Normal file
View file

@ -0,0 +1,36 @@
package config
import (
"testing"
v2 "github.com/datarhei/core/v16/config/v2"
"github.com/datarhei/core/v16/io/fs"
"github.com/stretchr/testify/require"
)
func TestUpgrade(t *testing.T) {
fs, _ := fs.NewMemFilesystem(fs.MemConfig{})
v2cfg := v2.New(fs)
v2cfg.Storage.Disk.Cache.Types = []string{".foo", ".bar"}
v3cfg, err := UpgradeV2ToV3(&v2cfg.Data, fs)
require.NoError(t, err)
require.Equal(t, int64(3), v3cfg.Version)
require.ElementsMatch(t, []string{".foo", ".bar"}, v3cfg.Storage.Disk.Cache.Types.Allow)
require.ElementsMatch(t, []string{".m3u8", ".mpd"}, v3cfg.Storage.Disk.Cache.Types.Block)
}
func TestDowngrade(t *testing.T) {
fs, _ := fs.NewMemFilesystem(fs.MemConfig{})
v3cfg := New(fs)
v3cfg.Storage.Disk.Cache.Types.Allow = []string{".foo", ".bar"}
v2cfg, err := DowngradeV3toV2(&v3cfg.Data)
require.NoError(t, err)
require.Equal(t, int64(2), v2cfg.Version)
require.ElementsMatch(t, []string{".foo", ".bar"}, v2cfg.Storage.Disk.Cache.Types)
}

View file

@ -1,73 +0,0 @@
package store
import (
"fmt"
"github.com/datarhei/core/v16/config"
)
type dummyStore struct {
current *config.Config
active *config.Config
}
// NewDummyStore returns a store that returns the default config
func NewDummy() Store {
s := &dummyStore{}
cfg := config.New()
cfg.DB.Dir = "."
cfg.FFmpeg.Binary = "true"
cfg.Storage.Disk.Dir = "."
cfg.Storage.MimeTypes = ""
s.current = cfg
cfg = config.New()
cfg.DB.Dir = "."
cfg.FFmpeg.Binary = "true"
cfg.Storage.Disk.Dir = "."
cfg.Storage.MimeTypes = ""
s.active = cfg
return s
}
func (c *dummyStore) Get() *config.Config {
return c.current.Clone()
}
func (c *dummyStore) Set(d *config.Config) error {
d.Validate(true)
if d.HasErrors() {
return fmt.Errorf("configuration data has errors after validation")
}
c.current = d.Clone()
return nil
}
func (c *dummyStore) GetActive() *config.Config {
return c.active.Clone()
}
func (c *dummyStore) SetActive(d *config.Config) error {
d.Validate(true)
if d.HasErrors() {
return fmt.Errorf("configuration data has errors after validation")
}
c.active = d.Clone()
return nil
}
func (c *dummyStore) Reload() error {
return nil
}

View file

@ -10,10 +10,11 @@ import (
v1 "github.com/datarhei/core/v16/config/v1" v1 "github.com/datarhei/core/v16/config/v1"
v2 "github.com/datarhei/core/v16/config/v2" v2 "github.com/datarhei/core/v16/config/v2"
"github.com/datarhei/core/v16/encoding/json" "github.com/datarhei/core/v16/encoding/json"
"github.com/datarhei/core/v16/io/file" "github.com/datarhei/core/v16/io/fs"
) )
type jsonStore struct { type jsonStore struct {
fs fs.Filesystem
path string path string
data map[string]*config.Config data map[string]*config.Config
@ -21,18 +22,32 @@ type jsonStore struct {
reloadFn func() reloadFn func()
} }
// NewJSONStore will read a JSON config file from the given path. After successfully reading it in, it will be written // NewJSONStore will read the JSON config file from the given path. After successfully reading it in, it will be written
// back to the path. The returned error will be nil if everything went fine. // back to the path. The returned error will be nil if everything went fine. If the path doesn't exist, a default JSON
// If the path doesn't exist, a default JSON config file will be written to that path. // config file will be written to that path. The returned ConfigStore can be used to retrieve or write the config.
// The returned ConfigStore can be used to retrieve or write the config. func NewJSON(f fs.Filesystem, path string, reloadFn func()) (Store, error) {
func NewJSON(path string, reloadFn func()) (Store, error) {
c := &jsonStore{ c := &jsonStore{
path: path, fs: f,
data: make(map[string]*config.Config), data: make(map[string]*config.Config),
reloadFn: reloadFn, reloadFn: reloadFn,
} }
c.data["base"] = config.New() path, err := filepath.Abs(path)
if err != nil {
return nil, fmt.Errorf("failed to determine absolute path of '%s': %w", path, err)
}
c.path = path
if len(c.path) == 0 {
c.path = "/config.json"
}
if c.fs == nil {
return nil, fmt.Errorf("no valid filesystem provided")
}
c.data["base"] = config.New(f)
if err := c.load(c.data["base"]); err != nil { if err := c.load(c.data["base"]); err != nil {
return nil, fmt.Errorf("failed to read JSON from '%s': %w", path, err) return nil, fmt.Errorf("failed to read JSON from '%s': %w", path, err)
@ -106,11 +121,11 @@ func (c *jsonStore) load(cfg *config.Config) error {
return nil return nil
} }
if _, err := os.Stat(c.path); os.IsNotExist(err) { if _, err := c.fs.Stat(c.path); os.IsNotExist(err) {
return nil return nil
} }
jsondata, err := os.ReadFile(c.path) jsondata, err := c.fs.ReadFile(c.path)
if err != nil { if err != nil {
return err return err
} }
@ -141,28 +156,9 @@ func (c *jsonStore) store(data *config.Config) error {
return err return err
} }
dir, filename := filepath.Split(c.path) _, _, err = c.fs.WriteFileSafe(c.path, jsondata)
tmpfile, err := os.CreateTemp(dir, filename)
if err != nil {
return err return err
}
defer os.Remove(tmpfile.Name())
if _, err := tmpfile.Write(jsondata); err != nil {
return err
}
if err := tmpfile.Close(); err != nil {
return err
}
if err := file.Rename(tmpfile.Name(), c.path); err != nil {
return err
}
return nil
} }
func migrate(jsondata []byte) (*config.Data, error) { func migrate(jsondata []byte) (*config.Data, error) {
@ -174,38 +170,38 @@ func migrate(jsondata []byte) (*config.Data, error) {
} }
if version.Version == 1 { if version.Version == 1 {
dataV1 := &v1.New().Data dataV1 := &v1.New(nil).Data
if err := gojson.Unmarshal(jsondata, dataV1); err != nil { if err := gojson.Unmarshal(jsondata, dataV1); err != nil {
return nil, json.FormatError(jsondata, err) return nil, json.FormatError(jsondata, err)
} }
dataV2, err := v2.UpgradeV1ToV2(dataV1) dataV2, err := v2.UpgradeV1ToV2(dataV1, nil)
if err != nil { if err != nil {
return nil, err return nil, err
} }
dataV3, err := config.UpgradeV2ToV3(dataV2) dataV3, err := config.UpgradeV2ToV3(dataV2, nil)
if err != nil { if err != nil {
return nil, err return nil, err
} }
data = dataV3 data = dataV3
} else if version.Version == 2 { } else if version.Version == 2 {
dataV2 := &v2.New().Data dataV2 := &v2.New(nil).Data
if err := gojson.Unmarshal(jsondata, dataV2); err != nil { if err := gojson.Unmarshal(jsondata, dataV2); err != nil {
return nil, json.FormatError(jsondata, err) return nil, json.FormatError(jsondata, err)
} }
dataV3, err := config.UpgradeV2ToV3(dataV2) dataV3, err := config.UpgradeV2ToV3(dataV2, nil)
if err != nil { if err != nil {
return nil, err return nil, err
} }
data = dataV3 data = dataV3
} else if version.Version == 3 { } else if version.Version == 3 {
dataV3 := &config.New().Data dataV3 := &config.New(nil).Data
if err := gojson.Unmarshal(jsondata, dataV3); err != nil { if err := gojson.Unmarshal(jsondata, dataV3); err != nil {
return nil, json.FormatError(jsondata, err) return nil, json.FormatError(jsondata, err)

View file

@ -18,7 +18,7 @@ func TestMigrationV1ToV3(t *testing.T) {
jsondatav3, err := os.ReadFile("./fixtures/config_v1_v3.json") jsondatav3, err := os.ReadFile("./fixtures/config_v1_v3.json")
require.NoError(t, err) require.NoError(t, err)
datav3 := config.New() datav3 := config.New(nil)
json.Unmarshal(jsondatav3, datav3) json.Unmarshal(jsondatav3, datav3)
data, err := migrate(jsondatav1) data, err := migrate(jsondatav1)
@ -37,7 +37,7 @@ func TestMigrationV2ToV3(t *testing.T) {
jsondatav3, err := os.ReadFile("./fixtures/config_v2_v3.json") jsondatav3, err := os.ReadFile("./fixtures/config_v2_v3.json")
require.NoError(t, err) require.NoError(t, err)
datav3 := config.New() datav3 := config.New(nil)
json.Unmarshal(jsondatav3, datav3) json.Unmarshal(jsondatav3, datav3)
data, err := migrate(jsondatav2) data, err := migrate(jsondatav2)

View file

@ -8,6 +8,7 @@ import (
"github.com/datarhei/core/v16/config/copy" "github.com/datarhei/core/v16/config/copy"
"github.com/datarhei/core/v16/config/value" "github.com/datarhei/core/v16/config/value"
"github.com/datarhei/core/v16/config/vars" "github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/math/rand" "github.com/datarhei/core/v16/math/rand"
haikunator "github.com/atrox/haikunatorgo/v2" haikunator "github.com/atrox/haikunatorgo/v2"
@ -21,14 +22,21 @@ const version int64 = 1
// Config is a wrapper for Data // Config is a wrapper for Data
type Config struct { type Config struct {
fs fs.Filesystem
vars vars.Variables vars vars.Variables
Data Data
} }
// New returns a Config which is initialized with its default values // New returns a Config which is initialized with its default values
func New() *Config { func New(f fs.Filesystem) *Config {
cfg := &Config{} cfg := &Config{
fs: f,
}
if cfg.fs == nil {
cfg.fs, _ = fs.NewMemFilesystem(fs.MemConfig{})
}
cfg.init() cfg.init()
@ -45,7 +53,7 @@ func (d *Config) Set(name, val string) error {
// NewConfigFrom returns a clone of a Config // NewConfigFrom returns a clone of a Config
func (d *Config) Clone() *Config { func (d *Config) Clone() *Config {
data := New() data := New(d.fs)
data.CreatedAt = d.CreatedAt data.CreatedAt = d.CreatedAt
data.LoadedAt = d.LoadedAt data.LoadedAt = d.LoadedAt
@ -118,7 +126,7 @@ func (d *Config) init() {
d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false) d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false)
// DB // DB
d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config"), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false) d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config", d.fs), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false)
// Host // Host
d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false) d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false)
@ -146,14 +154,14 @@ func (d *Config) init() {
d.vars.Register(value.NewAddress(&d.TLS.Address, ":8181"), "tls.address", "CORE_TLS_ADDRESS", nil, "HTTPS listening address", false, false) d.vars.Register(value.NewAddress(&d.TLS.Address, ":8181"), "tls.address", "CORE_TLS_ADDRESS", nil, "HTTPS listening address", false, false)
d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false) d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false)
d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false) d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false)
d.vars.Register(value.NewFile(&d.TLS.CertFile, ""), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.CertFile, "", d.fs), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false)
d.vars.Register(value.NewFile(&d.TLS.KeyFile, ""), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.KeyFile, "", d.fs), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false)
// Storage // Storage
d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types"), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false) d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types", d.fs), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false)
// Storage (Disk) // Storage (Disk)
d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data"), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false) d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data", d.fs), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false)
d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false) d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false)
d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false) d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false)
d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false) d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false)
@ -228,7 +236,7 @@ func (d *Config) init() {
// Router // Router
d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false) d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false)
d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false) d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false)
d.vars.Register(value.NewDir(&d.Router.UIPath, ""), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false) d.vars.Register(value.NewDir(&d.Router.UIPath, "", d.fs), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false)
} }
// Validate validates the current state of the Config for completeness and sanity. Errors are // Validate validates the current state of the Config for completeness and sanity. Errors are

View file

@ -8,6 +8,7 @@ import (
"github.com/datarhei/core/v16/config/copy" "github.com/datarhei/core/v16/config/copy"
"github.com/datarhei/core/v16/config/value" "github.com/datarhei/core/v16/config/value"
"github.com/datarhei/core/v16/config/vars" "github.com/datarhei/core/v16/config/vars"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/math/rand" "github.com/datarhei/core/v16/math/rand"
haikunator "github.com/atrox/haikunatorgo/v2" haikunator "github.com/atrox/haikunatorgo/v2"
@ -21,14 +22,21 @@ const version int64 = 2
// Config is a wrapper for Data // Config is a wrapper for Data
type Config struct { type Config struct {
fs fs.Filesystem
vars vars.Variables vars vars.Variables
Data Data
} }
// New returns a Config which is initialized with its default values // New returns a Config which is initialized with its default values
func New() *Config { func New(f fs.Filesystem) *Config {
cfg := &Config{} cfg := &Config{
fs: f,
}
if cfg.fs == nil {
cfg.fs, _ = fs.NewMemFilesystem(fs.MemConfig{})
}
cfg.init() cfg.init()
@ -45,7 +53,7 @@ func (d *Config) Set(name, val string) error {
// NewConfigFrom returns a clone of a Config // NewConfigFrom returns a clone of a Config
func (d *Config) Clone() *Config { func (d *Config) Clone() *Config {
data := New() data := New(d.fs)
data.CreatedAt = d.CreatedAt data.CreatedAt = d.CreatedAt
data.LoadedAt = d.LoadedAt data.LoadedAt = d.LoadedAt
@ -118,7 +126,7 @@ func (d *Config) init() {
d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false) d.vars.Register(value.NewInt(&d.Log.MaxLines, 1000), "log.max_lines", "CORE_LOG_MAXLINES", nil, "Number of latest log lines to keep in memory", false, false)
// DB // DB
d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config"), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false) d.vars.Register(value.NewMustDir(&d.DB.Dir, "./config", d.fs), "db.dir", "CORE_DB_DIR", nil, "Directory for holding the operational data", false, false)
// Host // Host
d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false) d.vars.Register(value.NewStringList(&d.Host.Name, []string{}, ","), "host.name", "CORE_HOST_NAME", nil, "Comma separated list of public host/domain names or IPs", false, false)
@ -146,14 +154,14 @@ func (d *Config) init() {
d.vars.Register(value.NewAddress(&d.TLS.Address, ":8181"), "tls.address", "CORE_TLS_ADDRESS", nil, "HTTPS listening address", false, false) d.vars.Register(value.NewAddress(&d.TLS.Address, ":8181"), "tls.address", "CORE_TLS_ADDRESS", nil, "HTTPS listening address", false, false)
d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false) d.vars.Register(value.NewBool(&d.TLS.Enable, false), "tls.enable", "CORE_TLS_ENABLE", nil, "Enable HTTPS", false, false)
d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false) d.vars.Register(value.NewBool(&d.TLS.Auto, false), "tls.auto", "CORE_TLS_AUTO", nil, "Enable Let's Encrypt certificate", false, false)
d.vars.Register(value.NewFile(&d.TLS.CertFile, ""), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.CertFile, "", d.fs), "tls.cert_file", "CORE_TLS_CERTFILE", nil, "Path to certificate file in PEM format", false, false)
d.vars.Register(value.NewFile(&d.TLS.KeyFile, ""), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false) d.vars.Register(value.NewFile(&d.TLS.KeyFile, "", d.fs), "tls.key_file", "CORE_TLS_KEYFILE", nil, "Path to key file in PEM format", false, false)
// Storage // Storage
d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types"), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false) d.vars.Register(value.NewFile(&d.Storage.MimeTypes, "./mime.types", d.fs), "storage.mimetypes_file", "CORE_STORAGE_MIMETYPES_FILE", []string{"CORE_MIMETYPES_FILE"}, "Path to file with mime-types", false, false)
// Storage (Disk) // Storage (Disk)
d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data"), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false) d.vars.Register(value.NewMustDir(&d.Storage.Disk.Dir, "./data", d.fs), "storage.disk.dir", "CORE_STORAGE_DISK_DIR", nil, "Directory on disk, exposed on /", false, false)
d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false) d.vars.Register(value.NewInt64(&d.Storage.Disk.Size, 0), "storage.disk.max_size_mbytes", "CORE_STORAGE_DISK_MAXSIZEMBYTES", nil, "Max. allowed megabytes for storage.disk.dir, 0 for unlimited", false, false)
d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false) d.vars.Register(value.NewBool(&d.Storage.Disk.Cache.Enable, true), "storage.disk.cache.enable", "CORE_STORAGE_DISK_CACHE_ENABLE", nil, "Enable cache for /", false, false)
d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false) d.vars.Register(value.NewUint64(&d.Storage.Disk.Cache.Size, 0), "storage.disk.cache.max_size_mbytes", "CORE_STORAGE_DISK_CACHE_MAXSIZEMBYTES", nil, "Max. allowed cache size, 0 for unlimited", false, false)
@ -229,7 +237,7 @@ func (d *Config) init() {
// Router // Router
d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false) d.vars.Register(value.NewStringList(&d.Router.BlockedPrefixes, []string{"/api"}, ","), "router.blocked_prefixes", "CORE_ROUTER_BLOCKED_PREFIXES", nil, "List of path prefixes that can't be routed", false, false)
d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false) d.vars.Register(value.NewStringMapString(&d.Router.Routes, nil), "router.routes", "CORE_ROUTER_ROUTES", nil, "List of route mappings", false, false)
d.vars.Register(value.NewDir(&d.Router.UIPath, ""), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false) d.vars.Register(value.NewDir(&d.Router.UIPath, "", d.fs), "router.ui_path", "CORE_ROUTER_UI_PATH", nil, "Path to a directory holding UI files mounted as /ui", false, false)
} }
// Validate validates the current state of the Config for completeness and sanity. Errors are // Validate validates the current state of the Config for completeness and sanity. Errors are

View file

@ -10,6 +10,7 @@ import (
"github.com/datarhei/core/v16/config/copy" "github.com/datarhei/core/v16/config/copy"
v1 "github.com/datarhei/core/v16/config/v1" v1 "github.com/datarhei/core/v16/config/v1"
"github.com/datarhei/core/v16/config/value" "github.com/datarhei/core/v16/config/value"
"github.com/datarhei/core/v16/io/fs"
) )
type Data struct { type Data struct {
@ -164,8 +165,8 @@ type Data struct {
} `json:"router"` } `json:"router"`
} }
func UpgradeV1ToV2(d *v1.Data) (*Data, error) { func UpgradeV1ToV2(d *v1.Data, fs fs.Filesystem) (*Data, error) {
cfg := New() cfg := New(fs)
return MergeV1ToV2(&cfg.Data, d) return MergeV1ToV2(&cfg.Data, d)
} }

View file

@ -2,43 +2,52 @@ package value
import ( import (
"fmt" "fmt"
"os"
"os/exec" "os/exec"
"path/filepath" "path/filepath"
"strings" "strings"
"github.com/datarhei/core/v16/io/fs"
) )
// must directory // must directory
type MustDir string type MustDir struct {
p *string
fs fs.Filesystem
}
func NewMustDir(p *string, val string, fs fs.Filesystem) *MustDir {
v := &MustDir{
p: p,
fs: fs,
}
func NewMustDir(p *string, val string) *MustDir {
*p = val *p = val
return (*MustDir)(p) return v
} }
func (u *MustDir) Set(val string) error { func (u *MustDir) Set(val string) error {
*u = MustDir(val) *u.p = val
return nil return nil
} }
func (u *MustDir) String() string { func (u *MustDir) String() string {
return string(*u) return *u.p
} }
func (u *MustDir) Validate() error { func (u *MustDir) Validate() error {
val := string(*u) val := *u.p
if len(strings.TrimSpace(val)) == 0 { if len(strings.TrimSpace(val)) == 0 {
return fmt.Errorf("path name must not be empty") return fmt.Errorf("path name must not be empty")
} }
if err := os.MkdirAll(val, 0750); err != nil { if err := u.fs.MkdirAll(val, 0750); err != nil {
return fmt.Errorf("%s can't be created (%w)", val, err) return fmt.Errorf("%s can't be created (%w)", val, err)
} }
finfo, err := os.Stat(val) finfo, err := u.fs.Stat(val)
if err != nil { if err != nil {
return fmt.Errorf("%s does not exist", val) return fmt.Errorf("%s does not exist", val)
} }
@ -51,36 +60,44 @@ func (u *MustDir) Validate() error {
} }
func (u *MustDir) IsEmpty() bool { func (u *MustDir) IsEmpty() bool {
return len(string(*u)) == 0 return len(*u.p) == 0
} }
// directory // directory
type Dir string type Dir struct {
p *string
fs fs.Filesystem
}
func NewDir(p *string, val string, fs fs.Filesystem) *Dir {
v := &Dir{
p: p,
fs: fs,
}
func NewDir(p *string, val string) *Dir {
*p = val *p = val
return (*Dir)(p) return v
} }
func (u *Dir) Set(val string) error { func (u *Dir) Set(val string) error {
*u = Dir(val) *u.p = val
return nil return nil
} }
func (u *Dir) String() string { func (u *Dir) String() string {
return string(*u) return *u.p
} }
func (u *Dir) Validate() error { func (u *Dir) Validate() error {
val := string(*u) val := *u.p
if len(strings.TrimSpace(val)) == 0 { if len(strings.TrimSpace(val)) == 0 {
return nil return nil
} }
finfo, err := os.Stat(val) finfo, err := u.fs.Stat(val)
if err != nil { if err != nil {
return fmt.Errorf("%s does not exist", val) return fmt.Errorf("%s does not exist", val)
} }
@ -93,7 +110,7 @@ func (u *Dir) Validate() error {
} }
func (u *Dir) IsEmpty() bool { func (u *Dir) IsEmpty() bool {
return len(string(*u)) == 0 return len(*u.p) == 0
} }
// executable // executable
@ -132,31 +149,39 @@ func (u *Exec) IsEmpty() bool {
// regular file // regular file
type File string type File struct {
p *string
fs fs.Filesystem
}
func NewFile(p *string, val string, fs fs.Filesystem) *File {
v := &File{
p: p,
fs: fs,
}
func NewFile(p *string, val string) *File {
*p = val *p = val
return (*File)(p) return v
} }
func (u *File) Set(val string) error { func (u *File) Set(val string) error {
*u = File(val) *u.p = val
return nil return nil
} }
func (u *File) String() string { func (u *File) String() string {
return string(*u) return *u.p
} }
func (u *File) Validate() error { func (u *File) Validate() error {
val := string(*u) val := *u.p
if len(val) == 0 { if len(val) == 0 {
return nil return nil
} }
finfo, err := os.Stat(val) finfo, err := u.fs.Stat(val)
if err != nil { if err != nil {
return fmt.Errorf("%s does not exist", val) return fmt.Errorf("%s does not exist", val)
} }
@ -169,7 +194,7 @@ func (u *File) Validate() error {
} }
func (u *File) IsEmpty() bool { func (u *File) IsEmpty() bool {
return len(string(*u)) == 0 return len(*u.p) == 0
} }
// absolute path // absolute path

View file

@ -1,6 +1,7 @@
package value package value
import ( import (
"sort"
"strconv" "strconv"
"strings" "strings"
) )
@ -127,11 +128,20 @@ func (s *StringMapString) String() string {
return "(empty)" return "(empty)"
} }
sms := *s.p
keys := []string{}
for k := range sms {
keys = append(keys, k)
}
sort.Strings(keys)
mappings := make([]string, len(*s.p)) mappings := make([]string, len(*s.p))
i := 0 i := 0
for k, v := range *s.p { for _, k := range keys {
mappings[i] = k + ":" + v mappings[i] = k + ":" + sms[k]
i++ i++
} }

View file

@ -337,452 +337,6 @@ const docTemplate = `{
} }
} }
}, },
"/api/v3/fs/disk": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "List all files on the filesystem. The listing can be ordered by name, size, or date of last modification in ascending or descending order.",
"produces": [
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "List all files on the filesystem",
"operationId": "diskfs-3-list-files",
"parameters": [
{
"type": "string",
"description": "glob pattern for file names",
"name": "glob",
"in": "query"
},
{
"type": "string",
"description": "none, name, size, lastmod",
"name": "sort",
"in": "query"
},
{
"type": "string",
"description": "asc, desc",
"name": "order",
"in": "query"
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "array",
"items": {
"$ref": "#/definitions/api.FileInfo"
}
}
}
}
}
},
"/api/v3/fs/disk/{path}": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Fetch a file from the filesystem. The contents of that file are returned.",
"produces": [
"application/data",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Fetch a file from the filesystem",
"operationId": "diskfs-3-get-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "file"
}
},
"301": {
"description": "Moved Permanently",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"put": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Writes or overwrites a file on the filesystem",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Add a file to the filesystem",
"operationId": "diskfs-3-put-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "File data",
"name": "data",
"in": "body",
"required": true,
"schema": {
"type": "array",
"items": {
"type": "integer"
}
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"204": {
"description": "No Content",
"schema": {
"type": "string"
}
},
"507": {
"description": "Insufficient Storage",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"delete": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Remove a file from the filesystem",
"produces": [
"text/plain"
],
"tags": [
"v16.7.2"
],
"summary": "Remove a file from the filesystem",
"operationId": "diskfs-3-delete-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
}
},
"/api/v3/fs/mem": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "List all files on the memory filesystem. The listing can be ordered by name, size, or date of last modification in ascending or descending order.",
"produces": [
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "List all files on the memory filesystem",
"operationId": "memfs-3-list-files",
"parameters": [
{
"type": "string",
"description": "glob pattern for file names",
"name": "glob",
"in": "query"
},
{
"type": "string",
"description": "none, name, size, lastmod",
"name": "sort",
"in": "query"
},
{
"type": "string",
"description": "asc, desc",
"name": "order",
"in": "query"
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "array",
"items": {
"$ref": "#/definitions/api.FileInfo"
}
}
}
}
}
},
"/api/v3/fs/mem/{path}": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Fetch a file from the memory filesystem",
"produces": [
"application/data",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Fetch a file from the memory filesystem",
"operationId": "memfs-3-get-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "file"
}
},
"301": {
"description": "Moved Permanently",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"put": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Writes or overwrites a file on the memory filesystem",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Add a file to the memory filesystem",
"operationId": "memfs-3-put-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "File data",
"name": "data",
"in": "body",
"required": true,
"schema": {
"type": "array",
"items": {
"type": "integer"
}
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"204": {
"description": "No Content",
"schema": {
"type": "string"
}
},
"507": {
"description": "Insufficient Storage",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"delete": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Remove a file from the memory filesystem",
"produces": [
"text/plain"
],
"tags": [
"v16.7.2"
],
"summary": "Remove a file from the memory filesystem",
"operationId": "memfs-3-delete-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"patch": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Create a link to a file in the memory filesystem. The file linked to has to exist.",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Create a link to a file in the memory filesystem",
"operationId": "memfs-3-patch",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "Path to the file to link to",
"name": "url",
"in": "body",
"required": true,
"schema": {
"type": "string"
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"400": {
"description": "Bad Request",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
}
},
"/api/v3/fs/{name}": { "/api/v3/fs/{name}": {
"get": { "get": {
"security": [ "security": [

View file

@ -329,452 +329,6 @@
} }
} }
}, },
"/api/v3/fs/disk": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "List all files on the filesystem. The listing can be ordered by name, size, or date of last modification in ascending or descending order.",
"produces": [
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "List all files on the filesystem",
"operationId": "diskfs-3-list-files",
"parameters": [
{
"type": "string",
"description": "glob pattern for file names",
"name": "glob",
"in": "query"
},
{
"type": "string",
"description": "none, name, size, lastmod",
"name": "sort",
"in": "query"
},
{
"type": "string",
"description": "asc, desc",
"name": "order",
"in": "query"
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "array",
"items": {
"$ref": "#/definitions/api.FileInfo"
}
}
}
}
}
},
"/api/v3/fs/disk/{path}": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Fetch a file from the filesystem. The contents of that file are returned.",
"produces": [
"application/data",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Fetch a file from the filesystem",
"operationId": "diskfs-3-get-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "file"
}
},
"301": {
"description": "Moved Permanently",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"put": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Writes or overwrites a file on the filesystem",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Add a file to the filesystem",
"operationId": "diskfs-3-put-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "File data",
"name": "data",
"in": "body",
"required": true,
"schema": {
"type": "array",
"items": {
"type": "integer"
}
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"204": {
"description": "No Content",
"schema": {
"type": "string"
}
},
"507": {
"description": "Insufficient Storage",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"delete": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Remove a file from the filesystem",
"produces": [
"text/plain"
],
"tags": [
"v16.7.2"
],
"summary": "Remove a file from the filesystem",
"operationId": "diskfs-3-delete-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
}
},
"/api/v3/fs/mem": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "List all files on the memory filesystem. The listing can be ordered by name, size, or date of last modification in ascending or descending order.",
"produces": [
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "List all files on the memory filesystem",
"operationId": "memfs-3-list-files",
"parameters": [
{
"type": "string",
"description": "glob pattern for file names",
"name": "glob",
"in": "query"
},
{
"type": "string",
"description": "none, name, size, lastmod",
"name": "sort",
"in": "query"
},
{
"type": "string",
"description": "asc, desc",
"name": "order",
"in": "query"
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "array",
"items": {
"$ref": "#/definitions/api.FileInfo"
}
}
}
}
}
},
"/api/v3/fs/mem/{path}": {
"get": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Fetch a file from the memory filesystem",
"produces": [
"application/data",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Fetch a file from the memory filesystem",
"operationId": "memfs-3-get-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "file"
}
},
"301": {
"description": "Moved Permanently",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"put": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Writes or overwrites a file on the memory filesystem",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Add a file to the memory filesystem",
"operationId": "memfs-3-put-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "File data",
"name": "data",
"in": "body",
"required": true,
"schema": {
"type": "array",
"items": {
"type": "integer"
}
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"204": {
"description": "No Content",
"schema": {
"type": "string"
}
},
"507": {
"description": "Insufficient Storage",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"delete": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Remove a file from the memory filesystem",
"produces": [
"text/plain"
],
"tags": [
"v16.7.2"
],
"summary": "Remove a file from the memory filesystem",
"operationId": "memfs-3-delete-file",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
}
],
"responses": {
"200": {
"description": "OK",
"schema": {
"type": "string"
}
},
"404": {
"description": "Not Found",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
},
"patch": {
"security": [
{
"ApiKeyAuth": []
}
],
"description": "Create a link to a file in the memory filesystem. The file linked to has to exist.",
"consumes": [
"application/data"
],
"produces": [
"text/plain",
"application/json"
],
"tags": [
"v16.7.2"
],
"summary": "Create a link to a file in the memory filesystem",
"operationId": "memfs-3-patch",
"parameters": [
{
"type": "string",
"description": "Path to file",
"name": "path",
"in": "path",
"required": true
},
{
"description": "Path to the file to link to",
"name": "url",
"in": "body",
"required": true,
"schema": {
"type": "string"
}
}
],
"responses": {
"201": {
"description": "Created",
"schema": {
"type": "string"
}
},
"400": {
"description": "Bad Request",
"schema": {
"$ref": "#/definitions/api.Error"
}
}
}
}
},
"/api/v3/fs/{name}": { "/api/v3/fs/{name}": {
"get": { "get": {
"security": [ "security": [

View file

@ -2266,298 +2266,6 @@ paths:
security: security:
- ApiKeyAuth: [] - ApiKeyAuth: []
summary: Add a file to a filesystem summary: Add a file to a filesystem
/api/v3/fs/disk:
get:
description: List all files on the filesystem. The listing can be ordered by
name, size, or date of last modification in ascending or descending order.
operationId: diskfs-3-list-files
parameters:
- description: glob pattern for file names
in: query
name: glob
type: string
- description: none, name, size, lastmod
in: query
name: sort
type: string
- description: asc, desc
in: query
name: order
type: string
produces:
- application/json
responses:
"200":
description: OK
schema:
items:
$ref: '#/definitions/api.FileInfo'
type: array
security:
- ApiKeyAuth: []
summary: List all files on the filesystem
tags:
- v16.7.2
/api/v3/fs/disk/{path}:
delete:
description: Remove a file from the filesystem
operationId: diskfs-3-delete-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
produces:
- text/plain
responses:
"200":
description: OK
schema:
type: string
"404":
description: Not Found
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Remove a file from the filesystem
tags:
- v16.7.2
get:
description: Fetch a file from the filesystem. The contents of that file are
returned.
operationId: diskfs-3-get-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
produces:
- application/data
- application/json
responses:
"200":
description: OK
schema:
type: file
"301":
description: Moved Permanently
schema:
type: string
"404":
description: Not Found
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Fetch a file from the filesystem
tags:
- v16.7.2
put:
consumes:
- application/data
description: Writes or overwrites a file on the filesystem
operationId: diskfs-3-put-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
- description: File data
in: body
name: data
required: true
schema:
items:
type: integer
type: array
produces:
- text/plain
- application/json
responses:
"201":
description: Created
schema:
type: string
"204":
description: No Content
schema:
type: string
"507":
description: Insufficient Storage
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Add a file to the filesystem
tags:
- v16.7.2
/api/v3/fs/mem:
get:
description: List all files on the memory filesystem. The listing can be ordered
by name, size, or date of last modification in ascending or descending order.
operationId: memfs-3-list-files
parameters:
- description: glob pattern for file names
in: query
name: glob
type: string
- description: none, name, size, lastmod
in: query
name: sort
type: string
- description: asc, desc
in: query
name: order
type: string
produces:
- application/json
responses:
"200":
description: OK
schema:
items:
$ref: '#/definitions/api.FileInfo'
type: array
security:
- ApiKeyAuth: []
summary: List all files on the memory filesystem
tags:
- v16.7.2
/api/v3/fs/mem/{path}:
delete:
description: Remove a file from the memory filesystem
operationId: memfs-3-delete-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
produces:
- text/plain
responses:
"200":
description: OK
schema:
type: string
"404":
description: Not Found
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Remove a file from the memory filesystem
tags:
- v16.7.2
get:
description: Fetch a file from the memory filesystem
operationId: memfs-3-get-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
produces:
- application/data
- application/json
responses:
"200":
description: OK
schema:
type: file
"301":
description: Moved Permanently
schema:
type: string
"404":
description: Not Found
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Fetch a file from the memory filesystem
tags:
- v16.7.2
patch:
consumes:
- application/data
description: Create a link to a file in the memory filesystem. The file linked
to has to exist.
operationId: memfs-3-patch
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
- description: Path to the file to link to
in: body
name: url
required: true
schema:
type: string
produces:
- text/plain
- application/json
responses:
"201":
description: Created
schema:
type: string
"400":
description: Bad Request
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Create a link to a file in the memory filesystem
tags:
- v16.7.2
put:
consumes:
- application/data
description: Writes or overwrites a file on the memory filesystem
operationId: memfs-3-put-file
parameters:
- description: Path to file
in: path
name: path
required: true
type: string
- description: File data
in: body
name: data
required: true
schema:
items:
type: integer
type: array
produces:
- text/plain
- application/json
responses:
"201":
description: Created
schema:
type: string
"204":
description: No Content
schema:
type: string
"507":
description: Insufficient Storage
schema:
$ref: '#/definitions/api.Error'
security:
- ApiKeyAuth: []
summary: Add a file to the memory filesystem
tags:
- v16.7.2
/api/v3/log: /api/v3/log:
get: get:
description: Get the last log lines of the Restreamer application description: Get the last log lines of the Restreamer application

55
go.mod
View file

@ -11,25 +11,25 @@ require (
github.com/datarhei/joy4 v0.0.0-20220914170649-23c70d207759 github.com/datarhei/joy4 v0.0.0-20220914170649-23c70d207759
github.com/go-playground/validator/v10 v10.11.1 github.com/go-playground/validator/v10 v10.11.1
github.com/gobwas/glob v0.2.3 github.com/gobwas/glob v0.2.3
github.com/golang-jwt/jwt/v4 v4.4.2 github.com/golang-jwt/jwt/v4 v4.4.3
github.com/google/uuid v1.3.0 github.com/google/uuid v1.3.0
github.com/invopop/jsonschema v0.4.0 github.com/invopop/jsonschema v0.4.0
github.com/joho/godotenv v1.4.0 github.com/joho/godotenv v1.4.0
github.com/labstack/echo/v4 v4.9.1 github.com/labstack/echo/v4 v4.9.1
github.com/lithammer/shortuuid/v4 v4.0.0 github.com/lithammer/shortuuid/v4 v4.0.0
github.com/mattn/go-isatty v0.0.16 github.com/mattn/go-isatty v0.0.17
github.com/minio/minio-go/v7 v7.0.39 github.com/minio/minio-go/v7 v7.0.47
github.com/prep/average v0.0.0-20200506183628-d26c465f48c3 github.com/prep/average v0.0.0-20200506183628-d26c465f48c3
github.com/prometheus/client_golang v1.13.1 github.com/prometheus/client_golang v1.14.0
github.com/shirou/gopsutil/v3 v3.22.10 github.com/shirou/gopsutil/v3 v3.22.11
github.com/stretchr/testify v1.8.1 github.com/stretchr/testify v1.8.1
github.com/swaggo/echo-swagger v1.3.5 github.com/swaggo/echo-swagger v1.3.5
github.com/swaggo/swag v1.8.7 github.com/swaggo/swag v1.8.7
github.com/vektah/gqlparser/v2 v2.5.1 github.com/vektah/gqlparser/v2 v2.5.1
github.com/xeipuuv/gojsonschema v1.2.0 github.com/xeipuuv/gojsonschema v1.2.0
go.uber.org/zap v1.23.0 go.uber.org/zap v1.24.0
golang.org/x/mod v0.6.0 golang.org/x/mod v0.7.0
golang.org/x/net v0.1.0 golang.org/x/net v0.5.0
) )
require ( require (
@ -37,14 +37,14 @@ require (
github.com/agnivade/levenshtein v1.1.1 // indirect github.com/agnivade/levenshtein v1.1.1 // indirect
github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c // indirect github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c // indirect
github.com/beorn7/perks v1.0.1 // indirect github.com/beorn7/perks v1.0.1 // indirect
github.com/cespare/xxhash/v2 v2.1.2 // indirect github.com/cespare/xxhash/v2 v2.2.0 // indirect
github.com/cpuguy83/go-md2man/v2 v2.0.1 // indirect github.com/cpuguy83/go-md2man/v2 v2.0.1 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect github.com/davecgh/go-spew v1.1.1 // indirect
github.com/dustin/go-humanize v1.0.0 // indirect github.com/dustin/go-humanize v1.0.1 // indirect
github.com/go-ole/go-ole v1.2.6 // indirect github.com/go-ole/go-ole v1.2.6 // indirect
github.com/go-openapi/jsonpointer v0.19.5 // indirect github.com/go-openapi/jsonpointer v0.19.5 // indirect
github.com/go-openapi/jsonreference v0.20.0 // indirect github.com/go-openapi/jsonreference v0.20.0 // indirect
github.com/go-openapi/spec v0.20.7 // indirect github.com/go-openapi/spec v0.20.8 // indirect
github.com/go-openapi/swag v0.22.3 // indirect github.com/go-openapi/swag v0.22.3 // indirect
github.com/go-playground/locales v0.14.0 // indirect github.com/go-playground/locales v0.14.0 // indirect
github.com/go-playground/universal-translator v0.18.0 // indirect github.com/go-playground/universal-translator v0.18.0 // indirect
@ -55,8 +55,8 @@ require (
github.com/iancoleman/orderedmap v0.2.0 // indirect github.com/iancoleman/orderedmap v0.2.0 // indirect
github.com/josharian/intern v1.0.0 // indirect github.com/josharian/intern v1.0.0 // indirect
github.com/json-iterator/go v1.1.12 // indirect github.com/json-iterator/go v1.1.12 // indirect
github.com/klauspost/compress v1.15.9 // indirect github.com/klauspost/compress v1.15.15 // indirect
github.com/klauspost/cpuid/v2 v2.1.2 // indirect github.com/klauspost/cpuid/v2 v2.2.3 // indirect
github.com/labstack/gommon v0.4.0 // indirect github.com/labstack/gommon v0.4.0 // indirect
github.com/leodido/go-urn v1.2.1 // indirect github.com/leodido/go-urn v1.2.1 // indirect
github.com/libdns/libdns v0.2.1 // indirect github.com/libdns/libdns v0.2.1 // indirect
@ -71,17 +71,19 @@ require (
github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/mitchellh/mapstructure v1.5.0 // indirect
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
github.com/modern-go/reflect2 v1.0.2 // indirect github.com/modern-go/reflect2 v1.0.2 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect github.com/pkg/errors v0.9.1 // indirect
github.com/power-devops/perfstat v0.0.0-20220216144756-c35f1ee13d7c // indirect github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect
github.com/power-devops/perfstat v0.0.0-20221212215047-62379fc7944b // indirect
github.com/prometheus/client_model v0.3.0 // indirect github.com/prometheus/client_model v0.3.0 // indirect
github.com/prometheus/common v0.37.0 // indirect github.com/prometheus/common v0.39.0 // indirect
github.com/prometheus/procfs v0.8.0 // indirect github.com/prometheus/procfs v0.9.0 // indirect
github.com/rogpeppe/go-internal v1.8.1 // indirect
github.com/rs/xid v1.4.0 // indirect github.com/rs/xid v1.4.0 // indirect
github.com/russross/blackfriday/v2 v2.1.0 // indirect github.com/russross/blackfriday/v2 v2.1.0 // indirect
github.com/sirupsen/logrus v1.9.0 // indirect github.com/sirupsen/logrus v1.9.0 // indirect
github.com/swaggo/files v0.0.0-20220728132757-551d4a08d97a // indirect github.com/swaggo/files v0.0.0-20220728132757-551d4a08d97a // indirect
github.com/tklauser/go-sysconf v0.3.10 // indirect github.com/tklauser/go-sysconf v0.3.11 // indirect
github.com/tklauser/numcpus v0.5.0 // indirect github.com/tklauser/numcpus v0.6.0 // indirect
github.com/urfave/cli/v2 v2.8.1 // indirect github.com/urfave/cli/v2 v2.8.1 // indirect
github.com/valyala/bytebufferpool v1.0.0 // indirect github.com/valyala/bytebufferpool v1.0.0 // indirect
github.com/valyala/fasttemplate v1.2.2 // indirect github.com/valyala/fasttemplate v1.2.2 // indirect
@ -90,13 +92,14 @@ require (
github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 // indirect github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 // indirect
github.com/yusufpapurcu/wmi v1.2.2 // indirect github.com/yusufpapurcu/wmi v1.2.2 // indirect
go.uber.org/atomic v1.10.0 // indirect go.uber.org/atomic v1.10.0 // indirect
go.uber.org/multierr v1.8.0 // indirect go.uber.org/goleak v1.1.12 // indirect
golang.org/x/crypto v0.1.0 // indirect go.uber.org/multierr v1.9.0 // indirect
golang.org/x/sys v0.1.0 // indirect golang.org/x/crypto v0.5.0 // indirect
golang.org/x/text v0.4.0 // indirect golang.org/x/sys v0.4.0 // indirect
golang.org/x/time v0.1.0 // indirect golang.org/x/text v0.6.0 // indirect
golang.org/x/tools v0.2.0 // indirect golang.org/x/time v0.3.0 // indirect
golang.org/x/tools v0.4.0 // indirect
google.golang.org/protobuf v1.28.1 // indirect google.golang.org/protobuf v1.28.1 // indirect
gopkg.in/ini.v1 v1.66.6 // indirect gopkg.in/ini.v1 v1.67.0 // indirect
gopkg.in/yaml.v3 v3.0.1 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect
) )

510
go.sum
View file

@ -1,41 +1,7 @@
cloud.google.com/go v0.26.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw=
cloud.google.com/go v0.34.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw=
cloud.google.com/go v0.38.0/go.mod h1:990N+gfupTy94rShfmMCWGDn0LpTmnzTp2qbd1dvSRU=
cloud.google.com/go v0.44.1/go.mod h1:iSa0KzasP4Uvy3f1mN/7PiObzGgflwredwwASm/v6AU=
cloud.google.com/go v0.44.2/go.mod h1:60680Gw3Yr4ikxnPRS/oxxkBccT6SA1yMk63TGekxKY=
cloud.google.com/go v0.45.1/go.mod h1:RpBamKRgapWJb87xiFSdk4g1CME7QZg3uwTez+TSTjc=
cloud.google.com/go v0.46.3/go.mod h1:a6bKKbmY7er1mI7TEI4lsAkts/mkhTSZK8w33B4RAg0=
cloud.google.com/go v0.50.0/go.mod h1:r9sluTvynVuxRIOHXQEHMFffphuXHOMZMycpNR5e6To=
cloud.google.com/go v0.52.0/go.mod h1:pXajvRH/6o3+F9jDHZWQ5PbGhn+o8w9qiu/CffaVdO4=
cloud.google.com/go v0.53.0/go.mod h1:fp/UouUEsRkN6ryDKNW/Upv/JBKnv6WDthjR6+vze6M=
cloud.google.com/go v0.54.0/go.mod h1:1rq2OEkV3YMf6n/9ZvGWI3GWw0VoqH/1x2nd8Is/bPc=
cloud.google.com/go v0.56.0/go.mod h1:jr7tqZxxKOVYizybht9+26Z/gUq7tiRzu+ACVAMbKVk=
cloud.google.com/go v0.57.0/go.mod h1:oXiQ6Rzq3RAkkY7N6t3TcE6jE+CIBBbA36lwQ1JyzZs=
cloud.google.com/go v0.62.0/go.mod h1:jmCYTdRCQuc1PHIIJ/maLInMho30T/Y0M4hTdTShOYc=
cloud.google.com/go v0.65.0/go.mod h1:O5N8zS7uWy9vkA9vayVHs65eM1ubvY4h553ofrNHObY=
cloud.google.com/go/bigquery v1.0.1/go.mod h1:i/xbL2UlR5RvWAURpBYZTtm/cXjCha9lbfbpx4poX+o=
cloud.google.com/go/bigquery v1.3.0/go.mod h1:PjpwJnslEMmckchkHFfq+HTD2DmtT67aNFKH1/VBDHE=
cloud.google.com/go/bigquery v1.4.0/go.mod h1:S8dzgnTigyfTmLBfrtrhyYhwRxG72rYxvftPBK2Dvzc=
cloud.google.com/go/bigquery v1.5.0/go.mod h1:snEHRnqQbz117VIFhE8bmtwIDY80NLUZUMb4Nv6dBIg=
cloud.google.com/go/bigquery v1.7.0/go.mod h1://okPTzCYNXSlb24MZs83e2Do+h+VXtc4gLoIoXIAPc=
cloud.google.com/go/bigquery v1.8.0/go.mod h1:J5hqkt3O0uAFnINi6JXValWIb1v0goeZM77hZzJN/fQ=
cloud.google.com/go/datastore v1.0.0/go.mod h1:LXYbyblFSglQ5pkeyhO+Qmw7ukd3C+pD7TKLgZqpHYE=
cloud.google.com/go/datastore v1.1.0/go.mod h1:umbIZjpQpHh4hmRpGhH4tLFup+FVzqBi1b3c64qFpCk=
cloud.google.com/go/pubsub v1.0.1/go.mod h1:R0Gpsv3s54REJCy4fxDixWD93lHJMoZTyQ2kNxGRt3I=
cloud.google.com/go/pubsub v1.1.0/go.mod h1:EwwdRX2sKPjnvnqCa270oGRyludottCI76h+R3AArQw=
cloud.google.com/go/pubsub v1.2.0/go.mod h1:jhfEVHT8odbXTkndysNHCcx0awwzvfOlguIAii9o8iA=
cloud.google.com/go/pubsub v1.3.1/go.mod h1:i+ucay31+CNRpDW4Lu78I4xXG+O1r/MAHgjpRVR+TSU=
cloud.google.com/go/storage v1.0.0/go.mod h1:IhtSnM/ZTZV8YYJWCY8RULGVqBDmpoyjwiyrjsg+URw=
cloud.google.com/go/storage v1.5.0/go.mod h1:tpKbwo567HUNpVclU5sGELwQWBDZ8gh0ZeosJ0Rtdos=
cloud.google.com/go/storage v1.6.0/go.mod h1:N7U0C8pVQ/+NIKOBQyamJIeKQKkZ+mxpohlUTyfDhBk=
cloud.google.com/go/storage v1.8.0/go.mod h1:Wv1Oy7z6Yz3DshWRJFhqM/UCfaWIRTdp0RXyy7KQOVs=
cloud.google.com/go/storage v1.10.0/go.mod h1:FLPqc6j+Ki4BU591ie1oL6qBQGu2Bl/tZ9ullr3+Kg0=
dmitri.shuralyov.com/gpu/mtl v0.0.0-20190408044501-666a987793e9/go.mod h1:H6x//7gZCb22OMCxBHrMx7a5I7Hp++hsVxbQ4BYO7hU=
github.com/99designs/gqlgen v0.17.20 h1:O7WzccIhKB1dm+7g6dhQcULINftfiLSBg2l/mwbpJMw= github.com/99designs/gqlgen v0.17.20 h1:O7WzccIhKB1dm+7g6dhQcULINftfiLSBg2l/mwbpJMw=
github.com/99designs/gqlgen v0.17.20/go.mod h1:Mja2HI23kWT1VRH09hvWshFgOzKswpO20o4ScpJIES4= github.com/99designs/gqlgen v0.17.20/go.mod h1:Mja2HI23kWT1VRH09hvWshFgOzKswpO20o4ScpJIES4=
github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU=
github.com/BurntSushi/toml v1.1.0/go.mod h1:CxXYINrC8qIiEnFrOxCa7Jy5BFHlXnUU2pbicEuybxQ= github.com/BurntSushi/toml v1.1.0/go.mod h1:CxXYINrC8qIiEnFrOxCa7Jy5BFHlXnUU2pbicEuybxQ=
github.com/BurntSushi/xgb v0.0.0-20160522181843-27f122750802/go.mod h1:IVnqGOEym/WlBOVXweHU+Q+/VP0lqqI8lqeDx9IjBqo=
github.com/KyleBanks/depth v1.2.1 h1:5h8fQADFrWtarTdtDudMmGsC7GPbOAu6RVB3ffsVFHc= github.com/KyleBanks/depth v1.2.1 h1:5h8fQADFrWtarTdtDudMmGsC7GPbOAu6RVB3ffsVFHc=
github.com/KyleBanks/depth v1.2.1/go.mod h1:jzSb9d0L43HxTQfT+oSA1EEp2q+ne2uh6XgeJcm8brE= github.com/KyleBanks/depth v1.2.1/go.mod h1:jzSb9d0L43HxTQfT+oSA1EEp2q+ne2uh6XgeJcm8brE=
github.com/Masterminds/semver/v3 v3.1.1 h1:hLg3sBzpNErnxhQtUy/mmLR2I9foDujNK030IGemrRc= github.com/Masterminds/semver/v3 v3.1.1 h1:hLg3sBzpNErnxhQtUy/mmLR2I9foDujNK030IGemrRc=
@ -46,11 +12,6 @@ github.com/agiledragon/gomonkey/v2 v2.3.1/go.mod h1:ap1AmDzcVOAz1YpeJ3TCzIgstoaW
github.com/agnivade/levenshtein v1.0.1/go.mod h1:CURSv5d9Uaml+FovSIICkLbAUZ9S4RqaHDIsdSBg7lM= github.com/agnivade/levenshtein v1.0.1/go.mod h1:CURSv5d9Uaml+FovSIICkLbAUZ9S4RqaHDIsdSBg7lM=
github.com/agnivade/levenshtein v1.1.1 h1:QY8M92nrzkmr798gCo3kmMyqXFzdQVpxLlGPRBij0P8= github.com/agnivade/levenshtein v1.1.1 h1:QY8M92nrzkmr798gCo3kmMyqXFzdQVpxLlGPRBij0P8=
github.com/agnivade/levenshtein v1.1.1/go.mod h1:veldBMzWxcCG2ZvUTKD2kJNRdCk5hVbJomOvKkmgYbo= github.com/agnivade/levenshtein v1.1.1/go.mod h1:veldBMzWxcCG2ZvUTKD2kJNRdCk5hVbJomOvKkmgYbo=
github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc=
github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc=
github.com/alecthomas/units v0.0.0-20151022065526-2efee857e7cf/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0=
github.com/alecthomas/units v0.0.0-20190717042225-c3de453c63f4/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0=
github.com/alecthomas/units v0.0.0-20190924025748-f65c72e2690d/go.mod h1:rBZYJk541a8SKzHPHnH3zbiI+7dagKZ0cgpgrD7Fyho=
github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883 h1:bvNMNQO63//z+xNgfBlViaCIJKLlCJ6/fmUseuG0wVQ= github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883 h1:bvNMNQO63//z+xNgfBlViaCIJKLlCJ6/fmUseuG0wVQ=
github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883/go.mod h1:rCTlJbsFo29Kk6CurOXKm700vrz8f0KW0JNfpkRJY/8= github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883/go.mod h1:rCTlJbsFo29Kk6CurOXKm700vrz8f0KW0JNfpkRJY/8=
github.com/arbovm/levenshtein v0.0.0-20160628152529-48b4e1c0c4d0 h1:jfIu9sQUG6Ig+0+Ap1h4unLjW6YQJpKZVmUzxsD4E/Q= github.com/arbovm/levenshtein v0.0.0-20160628152529-48b4e1c0c4d0 h1:jfIu9sQUG6Ig+0+Ap1h4unLjW6YQJpKZVmUzxsD4E/Q=
@ -61,21 +22,12 @@ github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLj
github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA= github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA=
github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c h1:8XZeJrs4+ZYhJeJ2aZxADI2tGADS15AzIF8MQ8XAhT4= github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c h1:8XZeJrs4+ZYhJeJ2aZxADI2tGADS15AzIF8MQ8XAhT4=
github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c/go.mod h1:x1vxHcL/9AVzuk5HOloOEPrtJY0MaalYr78afXZ+pWI= github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c/go.mod h1:x1vxHcL/9AVzuk5HOloOEPrtJY0MaalYr78afXZ+pWI=
github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q=
github.com/beorn7/perks v1.0.0/go.mod h1:KWe93zE9D1o94FZ5RNwFwVgaQK1VOXiVxmqh+CedLV8=
github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM= github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM=
github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6rlkpw= github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6rlkpw=
github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE=
github.com/caddyserver/certmagic v0.17.2/go.mod h1:ouWUuC490GOLJzkyN35eXfV8bSbwMwSf4bdhkIxtdQE= github.com/caddyserver/certmagic v0.17.2/go.mod h1:ouWUuC490GOLJzkyN35eXfV8bSbwMwSf4bdhkIxtdQE=
github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU= github.com/cespare/xxhash/v2 v2.2.0 h1:DC2CZ1Ep5Y4k3ZQ899DldepgrayRUGE6BBZ/cd9Cj44=
github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= github.com/cespare/xxhash/v2 v2.2.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
github.com/cespare/xxhash/v2 v2.1.2 h1:YRXhKfTDauu4ajMg1TPgFO5jnlC2HCbmLXMcTG5cbYE=
github.com/cespare/xxhash/v2 v2.1.2/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
github.com/chzyer/logex v1.1.10/go.mod h1:+Ywpsq7O8HXn0nuIou7OrIPyXbp3wmkHB+jjWRnGsAI=
github.com/chzyer/readline v0.0.0-20180603132655-2972be24d48e/go.mod h1:nSuG5e5PlCu98SY8svDHJxuZscDgtXS6KTTbou5AhLI=
github.com/chzyer/test v0.0.0-20180213035817-a1ea475d72b1/go.mod h1:Q3SI9o4m/ZMnBNeIyt5eFwwo7qiLfzFZmjNmxjkiQlU=
github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw=
github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
github.com/cpuguy83/go-md2man/v2 v2.0.0-20190314233015-f79a8a8ca69d/go.mod h1:maD7wRr/U5Z6m/iR4s+kqSMx2CaBsrgA7czyZG/E6dU= github.com/cpuguy83/go-md2man/v2 v2.0.0-20190314233015-f79a8a8ca69d/go.mod h1:maD7wRr/U5Z6m/iR4s+kqSMx2CaBsrgA7czyZG/E6dU=
github.com/cpuguy83/go-md2man/v2 v2.0.1 h1:r/myEWzV9lfsM1tFLgDyu0atFtJ1fXn261LKYj/3DxU= github.com/cpuguy83/go-md2man/v2 v2.0.1 h1:r/myEWzV9lfsM1tFLgDyu0atFtJ1fXn261LKYj/3DxU=
github.com/cpuguy83/go-md2man/v2 v2.0.1/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= github.com/cpuguy83/go-md2man/v2 v2.0.1/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o=
@ -89,24 +41,9 @@ github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/dgryski/trifles v0.0.0-20200323201526-dd97f9abfb48 h1:fRzb/w+pyskVMQ+UbP35JkH8yB7MYb4q/qhBarqZE6g= github.com/dgryski/trifles v0.0.0-20200323201526-dd97f9abfb48 h1:fRzb/w+pyskVMQ+UbP35JkH8yB7MYb4q/qhBarqZE6g=
github.com/dgryski/trifles v0.0.0-20200323201526-dd97f9abfb48/go.mod h1:if7Fbed8SFyPtHLHbg49SI7NAdJiC5WIA09pe59rfAA= github.com/dgryski/trifles v0.0.0-20200323201526-dd97f9abfb48/go.mod h1:if7Fbed8SFyPtHLHbg49SI7NAdJiC5WIA09pe59rfAA=
github.com/dustin/go-humanize v1.0.0 h1:VSnTsYCnlFHaM2/igO1h6X3HA71jcobQuxemgkq4zYo= github.com/dustin/go-humanize v1.0.1 h1:GzkhY7T5VNhEkwH0PVJgjz+fX1rhBrR7pRT3mDkpeCY=
github.com/dustin/go-humanize v1.0.0/go.mod h1:HtrtbFcZ19U5GC7JDqmcUSB87Iq5E25KnS6fMYU6eOk= github.com/dustin/go-humanize v1.0.1/go.mod h1:Mu1zIs6XwVuF/gI1OepvI0qD18qycQx+mFykh5fBlto=
github.com/envoyproxy/go-control-plane v0.9.0/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4=
github.com/envoyproxy/go-control-plane v0.9.1-0.20191026205805-5f8ba28d4473/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4=
github.com/envoyproxy/go-control-plane v0.9.4/go.mod h1:6rpuAdCZL397s3pYoYcLgu1mIlRU8Am5FuJP05cCM98=
github.com/envoyproxy/protoc-gen-validate v0.1.0/go.mod h1:iSmxcyjqTsJpI2R4NaDN7+kN2VEUnK/pcBlmesArF7c=
github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeMEF04= github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeMEF04=
github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU=
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as=
github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as=
github.com/go-kit/log v0.1.0/go.mod h1:zbhenjAZHb184qTLMA9ZjW7ThYL0H2mk7Q6pNt4vbaY=
github.com/go-kit/log v0.2.0/go.mod h1:NwTd00d/i8cPZ3xOwwiv2PO5MOcx78fFErGNcVmBjv0=
github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE=
github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk=
github.com/go-logfmt/logfmt v0.5.0/go.mod h1:wCYkCAKZfumFQihp8CzCvQ3paCTfi41vtzG1KdI/P7A=
github.com/go-logfmt/logfmt v0.5.1/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KEVveWlfTs=
github.com/go-ole/go-ole v1.2.6 h1:/Fpf6oFPoeFik9ty7siob0G6Ke8QvQEuVcuChpwXzpY= github.com/go-ole/go-ole v1.2.6 h1:/Fpf6oFPoeFik9ty7siob0G6Ke8QvQEuVcuChpwXzpY=
github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0= github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0=
github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg= github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg=
@ -116,8 +53,8 @@ github.com/go-openapi/jsonreference v0.19.6/go.mod h1:diGHMEHg2IqXZGKxqyvWdfWU/a
github.com/go-openapi/jsonreference v0.20.0 h1:MYlu0sBgChmCfJxxUKZ8g1cPWFOB37YSZqewK7OKeyA= github.com/go-openapi/jsonreference v0.20.0 h1:MYlu0sBgChmCfJxxUKZ8g1cPWFOB37YSZqewK7OKeyA=
github.com/go-openapi/jsonreference v0.20.0/go.mod h1:Ag74Ico3lPc+zR+qjn4XBUmXymS4zJbYVCZmcgkasdo= github.com/go-openapi/jsonreference v0.20.0/go.mod h1:Ag74Ico3lPc+zR+qjn4XBUmXymS4zJbYVCZmcgkasdo=
github.com/go-openapi/spec v0.20.4/go.mod h1:faYFR1CvsJZ0mNsmsphTMSoRrNV3TEDoAM7FOEWeq8I= github.com/go-openapi/spec v0.20.4/go.mod h1:faYFR1CvsJZ0mNsmsphTMSoRrNV3TEDoAM7FOEWeq8I=
github.com/go-openapi/spec v0.20.7 h1:1Rlu/ZrOCCob0n+JKKJAWhNWMPW8bOZRg8FJaY+0SKI= github.com/go-openapi/spec v0.20.8 h1:ubHmXNY3FCIOinT8RNrrPfGc9t7I1qhPtdOGoG2AxRU=
github.com/go-openapi/spec v0.20.7/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= github.com/go-openapi/spec v0.20.8/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA=
github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk= github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk=
github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ= github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ=
github.com/go-openapi/swag v0.22.3 h1:yMBqmnQ0gyZvEb/+KzuWZOXgllrXT4SADYbvDaXHv/g= github.com/go-openapi/swag v0.22.3 h1:yMBqmnQ0gyZvEb/+KzuWZOXgllrXT4SADYbvDaXHv/g=
@ -130,110 +67,48 @@ github.com/go-playground/universal-translator v0.18.0 h1:82dyy6p4OuJq4/CByFNOn/j
github.com/go-playground/universal-translator v0.18.0/go.mod h1:UvRDBj+xPUEGrFYl+lu/H90nyDXpg0fqeB/AQUGNTVA= github.com/go-playground/universal-translator v0.18.0/go.mod h1:UvRDBj+xPUEGrFYl+lu/H90nyDXpg0fqeB/AQUGNTVA=
github.com/go-playground/validator/v10 v10.11.1 h1:prmOlTVv+YjZjmRmNSF3VmspqJIxJWXmqUsHwfTRRkQ= github.com/go-playground/validator/v10 v10.11.1 h1:prmOlTVv+YjZjmRmNSF3VmspqJIxJWXmqUsHwfTRRkQ=
github.com/go-playground/validator/v10 v10.11.1/go.mod h1:i+3WkQ1FvaUjjxh1kSvIA4dMGDBiPU55YFDl0WbKdWU= github.com/go-playground/validator/v10 v10.11.1/go.mod h1:i+3WkQ1FvaUjjxh1kSvIA4dMGDBiPU55YFDl0WbKdWU=
github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY=
github.com/gobwas/glob v0.2.3 h1:A4xDbljILXROh+kObIiy5kIaPYD8e96x1tgBhUI5J+Y= github.com/gobwas/glob v0.2.3 h1:A4xDbljILXROh+kObIiy5kIaPYD8e96x1tgBhUI5J+Y=
github.com/gobwas/glob v0.2.3/go.mod h1:d3Ez4x06l9bZtSvzIay5+Yzi0fmZzPgnTbPcKjJAkT8= github.com/gobwas/glob v0.2.3/go.mod h1:d3Ez4x06l9bZtSvzIay5+Yzi0fmZzPgnTbPcKjJAkT8=
github.com/gogo/protobuf v1.1.1/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ=
github.com/golang-jwt/jwt v3.2.2+incompatible h1:IfV12K8xAKAnZqdXVzCZ+TOjboZ2keLg81eXfW3O+oY= github.com/golang-jwt/jwt v3.2.2+incompatible h1:IfV12K8xAKAnZqdXVzCZ+TOjboZ2keLg81eXfW3O+oY=
github.com/golang-jwt/jwt v3.2.2+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I= github.com/golang-jwt/jwt v3.2.2+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I=
github.com/golang-jwt/jwt/v4 v4.4.2 h1:rcc4lwaZgFMCZ5jxF9ABolDcIHdBytAFgqFPbSJQAYs= github.com/golang-jwt/jwt/v4 v4.4.3 h1:Hxl6lhQFj4AnOX6MLrsCb/+7tCj7DxP7VA+2rDIq5AU=
github.com/golang-jwt/jwt/v4 v4.4.2/go.mod h1:m21LjoU+eqJr34lmDMbreY2eSTRJ1cv77w39/MY0Ch0= github.com/golang-jwt/jwt/v4 v4.4.3/go.mod h1:m21LjoU+eqJr34lmDMbreY2eSTRJ1cv77w39/MY0Ch0=
github.com/golang/glog v0.0.0-20160126235308-23def4e6c14b/go.mod h1:SBH7ygxi8pfUlaOkMMuAQtPIUF8ecWP5IEl/CR7VP2Q=
github.com/golang/groupcache v0.0.0-20190702054246-869f871628b6/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/golang/groupcache v0.0.0-20191227052852-215e87163ea7/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/golang/groupcache v0.0.0-20200121045136-8c9f03a8e57e/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/golang/mock v1.1.1/go.mod h1:oTYuIxOrZwtPieC+H1uAHpcLFnEyAGVDL/k47Jfbm0A=
github.com/golang/mock v1.2.0/go.mod h1:oTYuIxOrZwtPieC+H1uAHpcLFnEyAGVDL/k47Jfbm0A=
github.com/golang/mock v1.3.1/go.mod h1:sBzyDLLjw3U8JLTeZvSv8jJB+tU5PVekmnlKIyFUx0Y=
github.com/golang/mock v1.4.0/go.mod h1:UOMv5ysSaYNkG+OFQykRIcU/QvvxJf3p21QfJ2Bt3cw=
github.com/golang/mock v1.4.1/go.mod h1:UOMv5ysSaYNkG+OFQykRIcU/QvvxJf3p21QfJ2Bt3cw=
github.com/golang/mock v1.4.3/go.mod h1:UOMv5ysSaYNkG+OFQykRIcU/QvvxJf3p21QfJ2Bt3cw=
github.com/golang/mock v1.4.4/go.mod h1:l3mdAwkq5BuhzHwde/uurv3sEJeZMXNpwsxVWU71h+4=
github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U=
github.com/golang/protobuf v1.3.1/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U=
github.com/golang/protobuf v1.3.2/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U=
github.com/golang/protobuf v1.3.3/go.mod h1:vzj43D7+SQXF/4pzW/hwtAqwc6iTitCiVSaWz5lYuqw=
github.com/golang/protobuf v1.3.4/go.mod h1:vzj43D7+SQXF/4pzW/hwtAqwc6iTitCiVSaWz5lYuqw=
github.com/golang/protobuf v1.3.5/go.mod h1:6O5/vntMXwX2lRkT1hjjk0nAC1IDOTvTlVgjlRvqsdk= github.com/golang/protobuf v1.3.5/go.mod h1:6O5/vntMXwX2lRkT1hjjk0nAC1IDOTvTlVgjlRvqsdk=
github.com/golang/protobuf v1.4.0-rc.1/go.mod h1:ceaxUfeHdC40wWswd/P6IGgMaK3YpKi5j83Wpe3EHw8=
github.com/golang/protobuf v1.4.0-rc.1.0.20200221234624-67d41d38c208/go.mod h1:xKAWHe0F5eneWXFV3EuXVDTCmh+JuBKY0li0aMyXATA=
github.com/golang/protobuf v1.4.0-rc.2/go.mod h1:LlEzMj4AhA7rCAGe4KMBDvJI+AwstrUpVNzEA03Pprs=
github.com/golang/protobuf v1.4.0-rc.4.0.20200313231945-b860323f09d0/go.mod h1:WU3c8KckQ9AFe+yFwt9sWVRKCVIyN9cPHBJSNnbL67w=
github.com/golang/protobuf v1.4.0/go.mod h1:jodUvKwWbYaEsadDk5Fwe5c77LiNKVO9IDvqG2KuDX0=
github.com/golang/protobuf v1.4.1/go.mod h1:U8fpvMrcmy5pZrNK1lt4xCsGvpyWQ/VVv6QDs8UjoX8=
github.com/golang/protobuf v1.4.2/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw735rRwI=
github.com/golang/protobuf v1.4.3/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw735rRwI=
github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk= github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk=
github.com/golang/protobuf v1.5.2 h1:ROPKBNFfQgOUMifHyP+KYbvpjbdoFNs+aK7DXlji0Tw= github.com/golang/protobuf v1.5.2 h1:ROPKBNFfQgOUMifHyP+KYbvpjbdoFNs+aK7DXlji0Tw=
github.com/golang/protobuf v1.5.2/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= github.com/golang/protobuf v1.5.2/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY=
github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M=
github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.4.1/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.1/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.4/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.6/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.6/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38=
github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg=
github.com/google/martian v2.1.0+incompatible/go.mod h1:9I4somxYTbIHy5NJKHRl3wXiIaQGbYVAs8BPL6v8lEs=
github.com/google/martian/v3 v3.0.0/go.mod h1:y5Zk1BBys9G+gd6Jrk0W3cC1+ELVxBWuIGO+w/tUAp0=
github.com/google/pprof v0.0.0-20181206194817-3ea8567a2e57/go.mod h1:zfwlbNMJ+OItoe0UupaVj+oy1omPYYDuagoSzA8v9mc=
github.com/google/pprof v0.0.0-20190515194954-54271f7e092f/go.mod h1:zfwlbNMJ+OItoe0UupaVj+oy1omPYYDuagoSzA8v9mc=
github.com/google/pprof v0.0.0-20191218002539-d4f498aebedc/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
github.com/google/pprof v0.0.0-20200212024743-f11f1df84d12/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
github.com/google/pprof v0.0.0-20200229191704-1ebb73c60ed3/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
github.com/google/pprof v0.0.0-20200430221834-fc25d7d30c6d/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
github.com/google/pprof v0.0.0-20200708004538-1a94d8640e99/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI=
github.com/google/uuid v1.3.0 h1:t6JiXgmwXMjEs8VusXIJk2BXHsn+wx8BZdTaoZ5fu7I= github.com/google/uuid v1.3.0 h1:t6JiXgmwXMjEs8VusXIJk2BXHsn+wx8BZdTaoZ5fu7I=
github.com/google/uuid v1.3.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.3.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo=
github.com/googleapis/gax-go/v2 v2.0.4/go.mod h1:0Wqv26UfaUD9n4G6kQubkQ+KchISgw+vpHVxEJEs9eg=
github.com/googleapis/gax-go/v2 v2.0.5/go.mod h1:DWXyrwAJ9X0FpwwEdw+IPEYBICEFu5mhpdKc/us6bOk=
github.com/gopherjs/gopherjs v0.0.0-20181017120253-0766667cb4d1/go.mod h1:wJfORRmW1u3UXTncJ5qlYoELFm8eSnnEO6hX4iZ3EWY= github.com/gopherjs/gopherjs v0.0.0-20181017120253-0766667cb4d1/go.mod h1:wJfORRmW1u3UXTncJ5qlYoELFm8eSnnEO6hX4iZ3EWY=
github.com/gorilla/websocket v1.5.0 h1:PPwGk2jz7EePpoHN/+ClbZu8SPxiqlu12wZP/3sWmnc= github.com/gorilla/websocket v1.5.0 h1:PPwGk2jz7EePpoHN/+ClbZu8SPxiqlu12wZP/3sWmnc=
github.com/gorilla/websocket v1.5.0/go.mod h1:YR8l580nyteQvAITg2hZ9XVh4b55+EU/adAjf1fMHhE= github.com/gorilla/websocket v1.5.0/go.mod h1:YR8l580nyteQvAITg2hZ9XVh4b55+EU/adAjf1fMHhE=
github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8=
github.com/hashicorp/golang-lru v0.5.1/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8=
github.com/hashicorp/golang-lru v0.5.4 h1:YDjusn29QI/Das2iO9M0BHnIbxPeyuCHsjMW+lJfyTc= github.com/hashicorp/golang-lru v0.5.4 h1:YDjusn29QI/Das2iO9M0BHnIbxPeyuCHsjMW+lJfyTc=
github.com/hashicorp/golang-lru v0.5.4/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4= github.com/hashicorp/golang-lru v0.5.4/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4=
github.com/iancoleman/orderedmap v0.0.0-20190318233801-ac98e3ecb4b0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA= github.com/iancoleman/orderedmap v0.0.0-20190318233801-ac98e3ecb4b0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA=
github.com/iancoleman/orderedmap v0.2.0 h1:sq1N/TFpYH++aViPcaKjys3bDClUEU7s5B+z6jq8pNA= github.com/iancoleman/orderedmap v0.2.0 h1:sq1N/TFpYH++aViPcaKjys3bDClUEU7s5B+z6jq8pNA=
github.com/iancoleman/orderedmap v0.2.0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA= github.com/iancoleman/orderedmap v0.2.0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA=
github.com/ianlancetaylor/demangle v0.0.0-20181102032728-5e5cf60278f6/go.mod h1:aSSvb/t6k1mPoxDqO4vJh6VOCGPwU4O0C2/Eqndh1Sc=
github.com/invopop/jsonschema v0.4.0 h1:Yuy/unfgCnfV5Wl7H0HgFufp/rlurqPOOuacqyByrws= github.com/invopop/jsonschema v0.4.0 h1:Yuy/unfgCnfV5Wl7H0HgFufp/rlurqPOOuacqyByrws=
github.com/invopop/jsonschema v0.4.0/go.mod h1:O9uiLokuu0+MGFlyiaqtWxwqJm41/+8Nj0lD7A36YH0= github.com/invopop/jsonschema v0.4.0/go.mod h1:O9uiLokuu0+MGFlyiaqtWxwqJm41/+8Nj0lD7A36YH0=
github.com/joho/godotenv v1.4.0 h1:3l4+N6zfMWnkbPEXKng2o2/MR5mSwTrBih4ZEkkz1lg= github.com/joho/godotenv v1.4.0 h1:3l4+N6zfMWnkbPEXKng2o2/MR5mSwTrBih4ZEkkz1lg=
github.com/joho/godotenv v1.4.0/go.mod h1:f4LDr5Voq0i2e/R5DDNOoa2zzDfwtkZa6DnEwAbqwq4= github.com/joho/godotenv v1.4.0/go.mod h1:f4LDr5Voq0i2e/R5DDNOoa2zzDfwtkZa6DnEwAbqwq4=
github.com/josharian/intern v1.0.0 h1:vlS4z54oSdjm0bgjRigI+G1HpF+tI+9rE5LLzOg8HmY= github.com/josharian/intern v1.0.0 h1:vlS4z54oSdjm0bgjRigI+G1HpF+tI+9rE5LLzOg8HmY=
github.com/josharian/intern v1.0.0/go.mod h1:5DoeVV0s6jJacbCEi61lwdGj/aVlrQvzHFFd8Hwg//Y= github.com/josharian/intern v1.0.0/go.mod h1:5DoeVV0s6jJacbCEi61lwdGj/aVlrQvzHFFd8Hwg//Y=
github.com/jpillora/backoff v1.0.0/go.mod h1:J/6gKK9jxlEcS3zixgDgUAsiuZ7yrSoa/FX5e0EB2j4=
github.com/json-iterator/go v1.1.6/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU=
github.com/json-iterator/go v1.1.10/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4=
github.com/json-iterator/go v1.1.11/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4=
github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnrnM= github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnrnM=
github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo= github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo=
github.com/jstemmer/go-junit-report v0.0.0-20190106144839-af01ea7f8024/go.mod h1:6v2b51hI/fHJwM22ozAgKL4VKDeJcHhJFhtBdhmNjmU=
github.com/jstemmer/go-junit-report v0.9.1/go.mod h1:Brl9GWCQeLvo8nXZwPNNblvFj/XSXhF0NWZEnDohbsk=
github.com/jtolds/gls v4.20.0+incompatible/go.mod h1:QJZ7F/aHp+rZTRtaJ1ow/lLfFfVYBRgL+9YlvaHOwJU= github.com/jtolds/gls v4.20.0+incompatible/go.mod h1:QJZ7F/aHp+rZTRtaJ1ow/lLfFfVYBRgL+9YlvaHOwJU=
github.com/julienschmidt/httprouter v1.2.0/go.mod h1:SYymIcj16QtmaHHD7aYtjjsJG7VTCxuUUipMqKk8s4w=
github.com/julienschmidt/httprouter v1.3.0/go.mod h1:JR6WtHb+2LUe8TCKY3cZOxFyyO8IZAc4RVcycCCAKdM=
github.com/kevinmbeaulieu/eq-go v1.0.0/go.mod h1:G3S8ajA56gKBZm4UB9AOyoOS37JO3roToPzKNM8dtdM= github.com/kevinmbeaulieu/eq-go v1.0.0/go.mod h1:G3S8ajA56gKBZm4UB9AOyoOS37JO3roToPzKNM8dtdM=
github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/compress v1.15.15 h1:EF27CXIuDsYJ6mmvtBRlEuB2UVOqHG1tAXgZ7yIO+lw=
github.com/klauspost/compress v1.15.9 h1:wKRjX6JRtDdrE9qwa4b/Cip7ACOshUI4smpCQanqjSY= github.com/klauspost/compress v1.15.15/go.mod h1:ZcK2JAFqKOpnBlxcLsJzYfrS9X1akm9fHZNnD9+Vo/4=
github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHUDtV4Yw2GlzU=
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.0.4/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.4/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.1.2 h1:XhdX4fqAJUA0yj+kUwMavO0hHrSPAecYdYf1ZmxHvak= github.com/klauspost/cpuid/v2 v2.2.3 h1:sxCkb+qR91z4vsqw4vGGZlDgPz3G7gjaLyK3V8y70BU=
github.com/klauspost/cpuid/v2 v2.1.2/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY= github.com/klauspost/cpuid/v2 v2.2.3/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
github.com/kr/pretty v0.3.0 h1:WgNl7dwNpEZ6jJ9k1snq4pZsg7DOEN8hP9Xw0Tsjwk0= github.com/kr/pretty v0.3.0 h1:WgNl7dwNpEZ6jJ9k1snq4pZsg7DOEN8hP9Xw0Tsjwk0=
@ -268,9 +143,9 @@ github.com/mattn/go-colorable v0.1.11/go.mod h1:u5H1YNBxpqRaxsYJYSkiCWKzEfiAb1Gb
github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA=
github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg=
github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94=
github.com/mattn/go-isatty v0.0.16 h1:bq3VjFmv/sOjHtdEhmkEV4x1AJtvUvOJ2PFAZ5+peKQ=
github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM=
github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/mattn/go-isatty v0.0.17 h1:BTarxUcIeDqL27Mc+vyvdWYSL28zpIhv3RoTdsLMPng=
github.com/mattn/go-isatty v0.0.17/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM=
github.com/matttproud/golang_protobuf_extensions v1.0.4 h1:mmDVorXM7PCGKw94cs5zkfA9PSy5pEvNWRP0ET0TIVo= github.com/matttproud/golang_protobuf_extensions v1.0.4 h1:mmDVorXM7PCGKw94cs5zkfA9PSy5pEvNWRP0ET0TIVo=
github.com/matttproud/golang_protobuf_extensions v1.0.4/go.mod h1:BSXmuO+STAnVfrANrmjBb36TMTDstsz7MSK+HVaYKv4= github.com/matttproud/golang_protobuf_extensions v1.0.4/go.mod h1:BSXmuO+STAnVfrANrmjBb36TMTDstsz7MSK+HVaYKv4=
github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80=
@ -279,8 +154,8 @@ github.com/miekg/dns v1.1.50 h1:DQUfb9uc6smULcREF09Uc+/Gd46YWqJd5DbpPE9xkcA=
github.com/miekg/dns v1.1.50/go.mod h1:e3IlAVfNqAllflbibAZEWOXOQ+Ynzk/dDozDxY7XnME= github.com/miekg/dns v1.1.50/go.mod h1:e3IlAVfNqAllflbibAZEWOXOQ+Ynzk/dDozDxY7XnME=
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
github.com/minio/minio-go/v7 v7.0.39 h1:upnbu1jCGOqEvrGSpRauSN9ZG7RCHK7VHxXS8Vmg2zk= github.com/minio/minio-go/v7 v7.0.47 h1:sLiuCKGSIcn/MI6lREmTzX91DX/oRau4ia0j6e6eOSs=
github.com/minio/minio-go/v7 v7.0.39/go.mod h1:nCrRzjoSUQh8hgKKtu3Y708OLvRLtuASMg2/nvmbarw= github.com/minio/minio-go/v7 v7.0.47/go.mod h1:nCrRzjoSUQh8hgKKtu3Y708OLvRLtuASMg2/nvmbarw=
github.com/minio/sha256-simd v1.0.0 h1:v1ta+49hkWZyvaKwrQB8elexRqm6Y0aMLjCNsrYxo6g= github.com/minio/sha256-simd v1.0.0 h1:v1ta+49hkWZyvaKwrQB8elexRqm6Y0aMLjCNsrYxo6g=
github.com/minio/sha256-simd v1.0.0/go.mod h1:OuYzVNI5vcoYIAmbIvHPl3N3jUzVedXbKy5RFepssQM= github.com/minio/sha256-simd v1.0.0/go.mod h1:OuYzVNI5vcoYIAmbIvHPl3N3jUzVedXbKy5RFepssQM=
github.com/mitchellh/mapstructure v1.3.1/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= github.com/mitchellh/mapstructure v1.3.1/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo=
@ -289,12 +164,8 @@ github.com/mitchellh/mapstructure v1.5.0/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RR
github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q=
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w8PVh93nsPXa1VrQ6jlwL5oN8l14QlcNfg= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w8PVh93nsPXa1VrQ6jlwL5oN8l14QlcNfg=
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q=
github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0=
github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0=
github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M= github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M=
github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk= github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk=
github.com/mwitkow/go-conntrack v0.0.0-20161129095857-cc309e4a2223/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U=
github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U=
github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e/go.mod h1:zD1mROLANZcx1PVRCS0qkT7pwLkGfwJo4zjcN/Tysno= github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e/go.mod h1:zD1mROLANZcx1PVRCS0qkT7pwLkGfwJo4zjcN/Tysno=
github.com/otiai10/copy v1.7.0/go.mod h1:rmRl6QPdJj6EiUqXQ/4Nn2lLXoNQjFCQbbNrxgc/t3U= github.com/otiai10/copy v1.7.0/go.mod h1:rmRl6QPdJj6EiUqXQ/4Nn2lLXoNQjFCQbbNrxgc/t3U=
github.com/otiai10/curr v0.0.0-20150429015615-9b4961190c95/go.mod h1:9qAhocn7zKJG+0mI8eUu6xqkFDYS2kb2saOteoSB3cE= github.com/otiai10/curr v0.0.0-20150429015615-9b4961190c95/go.mod h1:9qAhocn7zKJG+0mI8eUu6xqkFDYS2kb2saOteoSB3cE=
@ -302,48 +173,30 @@ github.com/otiai10/curr v1.0.0/go.mod h1:LskTG5wDwr8Rs+nNQ+1LlxRjAtTZZjtJW4rMXl6
github.com/otiai10/mint v1.3.0/go.mod h1:F5AjcsTsWUqX+Na9fpHb52P8pcRX2CI6A3ctIT91xUo= github.com/otiai10/mint v1.3.0/go.mod h1:F5AjcsTsWUqX+Na9fpHb52P8pcRX2CI6A3ctIT91xUo=
github.com/otiai10/mint v1.3.3/go.mod h1:/yxELlJQ0ufhjUwhshSj+wFjZ78CnZ48/1wtmBH1OTc= github.com/otiai10/mint v1.3.3/go.mod h1:/yxELlJQ0ufhjUwhshSj+wFjZ78CnZ48/1wtmBH1OTc=
github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA= github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pkg/profile v1.6.0/go.mod h1:qBsxPvzyUincmltOk6iyRVxHYg4adc0OFOv72ZdLa18= github.com/pkg/profile v1.6.0/go.mod h1:qBsxPvzyUincmltOk6iyRVxHYg4adc0OFOv72ZdLa18=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U=
github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE= github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE=
github.com/power-devops/perfstat v0.0.0-20220216144756-c35f1ee13d7c h1:NRoLoZvkBTKvR5gQLgA3e0hqjkY9u1wm+iOL45VN/qI= github.com/power-devops/perfstat v0.0.0-20221212215047-62379fc7944b h1:0LFwY6Q3gMACTjAbMZBjXAqTOzOwFaj2Ld6cjeQ7Rig=
github.com/power-devops/perfstat v0.0.0-20220216144756-c35f1ee13d7c/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE= github.com/power-devops/perfstat v0.0.0-20221212215047-62379fc7944b/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE=
github.com/prep/average v0.0.0-20200506183628-d26c465f48c3 h1:Y7qCvg282QmlyrVQuL2fgGwebuw7zvfnRym09r+dUGc= github.com/prep/average v0.0.0-20200506183628-d26c465f48c3 h1:Y7qCvg282QmlyrVQuL2fgGwebuw7zvfnRym09r+dUGc=
github.com/prep/average v0.0.0-20200506183628-d26c465f48c3/go.mod h1:0ZE5gcyWKS151WBDIpmLshHY0l+3edpuKnBUWVVbWKk= github.com/prep/average v0.0.0-20200506183628-d26c465f48c3/go.mod h1:0ZE5gcyWKS151WBDIpmLshHY0l+3edpuKnBUWVVbWKk=
github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= github.com/prometheus/client_golang v1.14.0 h1:nJdhIvne2eSX/XRAFV9PcvFFRbrjbcTUj0VP62TMhnw=
github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo= github.com/prometheus/client_golang v1.14.0/go.mod h1:8vpkKitgIVNcqrRBWh1C4TIUQgYNtG/XQE4E/Zae36Y=
github.com/prometheus/client_golang v1.7.1/go.mod h1:PY5Wy2awLA44sXw4AOSfFBetzPP4j5+D6mVACh+pe2M=
github.com/prometheus/client_golang v1.11.0/go.mod h1:Z6t4BnS23TR94PD6BsDNk8yVqroYurpAkEiz0P2BEV0=
github.com/prometheus/client_golang v1.12.1/go.mod h1:3Z9XVyYiZYEO+YQWt3RD2R3jrbd179Rt297l4aS6nDY=
github.com/prometheus/client_golang v1.13.1 h1:3gMjIY2+/hzmqhtUC/aQNYldJA6DtH3CgQvwS+02K1c=
github.com/prometheus/client_golang v1.13.1/go.mod h1:vTeo+zgvILHsnnj/39Ou/1fPN5nJFOEMgftOUOmlvYQ=
github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo=
github.com/prometheus/client_model v0.0.0-20190129233127-fd36f4220a90/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA=
github.com/prometheus/client_model v0.0.0-20190812154241-14fe0d1b01d4/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA=
github.com/prometheus/client_model v0.2.0/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA=
github.com/prometheus/client_model v0.3.0 h1:UBgGFHqYdG/TPFD1B1ogZywDqEkwp3fBMvqdiQ7Xew4= github.com/prometheus/client_model v0.3.0 h1:UBgGFHqYdG/TPFD1B1ogZywDqEkwp3fBMvqdiQ7Xew4=
github.com/prometheus/client_model v0.3.0/go.mod h1:LDGWKZIo7rky3hgvBe+caln+Dr3dPggB5dvjtD7w9+w= github.com/prometheus/client_model v0.3.0/go.mod h1:LDGWKZIo7rky3hgvBe+caln+Dr3dPggB5dvjtD7w9+w=
github.com/prometheus/common v0.4.1/go.mod h1:TNfzLD0ON7rHzMJeJkieUDPYmFC7Snx/y86RQel1bk4= github.com/prometheus/common v0.39.0 h1:oOyhkDq05hPZKItWVBkJ6g6AtGxi+fy7F4JvUV8uhsI=
github.com/prometheus/common v0.10.0/go.mod h1:Tlit/dnDKsSWFlCLTWaA1cyBgKHSMdTB80sz/V91rCo= github.com/prometheus/common v0.39.0/go.mod h1:6XBZ7lYdLCbkAVhwRsWTZn+IN5AB9F/NXd5w0BbEX0Y=
github.com/prometheus/common v0.26.0/go.mod h1:M7rCNAaPfAosfx8veZJCuw84e35h3Cfd9VFqTh1DIvc= github.com/prometheus/procfs v0.9.0 h1:wzCHvIvM5SxWqYvwgVL7yJY8Lz3PKn49KQtpgMYJfhI=
github.com/prometheus/common v0.32.1/go.mod h1:vu+V0TpY+O6vW9J44gczi3Ap/oXXR10b+M/gUGO4Hls= github.com/prometheus/procfs v0.9.0/go.mod h1:+pB4zwohETzFnmlpe6yd2lSc+0/46IYZRB/chUwxUZY=
github.com/prometheus/common v0.37.0 h1:ccBbHCgIiT9uSoFY0vX8H3zsNR5eLt17/RQLUvn8pXE=
github.com/prometheus/common v0.37.0/go.mod h1:phzohg0JFMnBEFGxTDbfu3QyL5GI8gTQJFhYO5B3mfA=
github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R/oaqEKCNdg8wHV1ftS6bRYblBhIjjI8uT2IGk=
github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsTZCD3I8kEA=
github.com/prometheus/procfs v0.1.3/go.mod h1:lV6e/gmhEcM9IjHGsFOCxxuZ+z1YqCvr4OA4YeYWdaU=
github.com/prometheus/procfs v0.6.0/go.mod h1:cz+aTbrPOrUb4q7XlbU9ygM+/jj0fzG6c1xBZuNvfVA=
github.com/prometheus/procfs v0.7.3/go.mod h1:cz+aTbrPOrUb4q7XlbU9ygM+/jj0fzG6c1xBZuNvfVA=
github.com/prometheus/procfs v0.8.0 h1:ODq8ZFEaYeCaZOJlZZdJA2AbQR98dSHSM1KW/You5mo=
github.com/prometheus/procfs v0.8.0/go.mod h1:z7EfXMXOkbkqb9IINtpCn86r/to3BnA0uaxHdg830/4=
github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4=
github.com/rogpeppe/go-internal v1.6.1/go.mod h1:xXDCJY+GAPziupqXw64V24skbSoqbTEfhy4qGm1nDQc= github.com/rogpeppe/go-internal v1.6.1/go.mod h1:xXDCJY+GAPziupqXw64V24skbSoqbTEfhy4qGm1nDQc=
github.com/rogpeppe/go-internal v1.8.0 h1:FCbCCtXNOY3UtUuHUYaghJg4y7Fd14rXifAYUAtL9R8=
github.com/rogpeppe/go-internal v1.8.0/go.mod h1:WmiCO8CzOY8rg0OYDC4/i/2WRWAB6poM+XZ2dLUbcbE= github.com/rogpeppe/go-internal v1.8.0/go.mod h1:WmiCO8CzOY8rg0OYDC4/i/2WRWAB6poM+XZ2dLUbcbE=
github.com/rogpeppe/go-internal v1.8.1 h1:geMPLpDpQOgVyCg5z5GoRwLHepNdb71NXb67XFkP+Eg=
github.com/rogpeppe/go-internal v1.8.1/go.mod h1:JeRgkft04UBgHMgCIwADu4Pn6Mtm5d4nPKWu0nJ5d+o=
github.com/rs/xid v1.4.0 h1:qd7wPTDkN6KQx2VmMBLrpHkiyQwgFXRnkOLacUiaSNY= github.com/rs/xid v1.4.0 h1:qd7wPTDkN6KQx2VmMBLrpHkiyQwgFXRnkOLacUiaSNY=
github.com/rs/xid v1.4.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg= github.com/rs/xid v1.4.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg=
github.com/russross/blackfriday/v2 v2.0.1/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= github.com/russross/blackfriday/v2 v2.0.1/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
@ -351,21 +204,16 @@ github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf
github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
github.com/sergi/go-diff v1.1.0 h1:we8PVUC3FE2uYfodKH/nBHMSetSfHDR6scGdBi+erh0= github.com/sergi/go-diff v1.1.0 h1:we8PVUC3FE2uYfodKH/nBHMSetSfHDR6scGdBi+erh0=
github.com/sergi/go-diff v1.1.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM= github.com/sergi/go-diff v1.1.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM=
github.com/shirou/gopsutil/v3 v3.22.10 h1:4KMHdfBRYXGF9skjDWiL4RA2N+E8dRdodU/bOZpPoVg= github.com/shirou/gopsutil/v3 v3.22.11 h1:kxsPKS+Eeo+VnEQ2XCaGJepeP6KY53QoRTETx3+1ndM=
github.com/shirou/gopsutil/v3 v3.22.10/go.mod h1:QNza6r4YQoydyCfo6rH0blGfKahgibh4dQmV5xdFkQk= github.com/shirou/gopsutil/v3 v3.22.11/go.mod h1:xl0EeL4vXJ+hQMAGN8B9VFpxukEMA0XdevQOe5MZ1oY=
github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc= github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc=
github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo=
github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE=
github.com/sirupsen/logrus v1.6.0/go.mod h1:7uNnSEd1DgxDLC74fIahvMZmmYsHGZGEOFrfsX/uA88=
github.com/sirupsen/logrus v1.9.0 h1:trlNQbNUG3OdDrDil03MCb1H2o9nJ1x4/5LYw7byDE0= github.com/sirupsen/logrus v1.9.0 h1:trlNQbNUG3OdDrDil03MCb1H2o9nJ1x4/5LYw7byDE0=
github.com/sirupsen/logrus v1.9.0/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/sirupsen/logrus v1.9.0/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ=
github.com/smartystreets/assertions v0.0.0-20180927180507-b2de0cb4f26d/go.mod h1:OnSkiWE9lh6wB0YB77sQom3nweQdgAjqCqsofrRNTgc= github.com/smartystreets/assertions v0.0.0-20180927180507-b2de0cb4f26d/go.mod h1:OnSkiWE9lh6wB0YB77sQom3nweQdgAjqCqsofrRNTgc=
github.com/smartystreets/goconvey v1.6.4/go.mod h1:syvi0/a8iFYH4r/RixwvyeAJjdLS9QV7WQ/tjFTllLA= github.com/smartystreets/goconvey v1.6.4/go.mod h1:syvi0/a8iFYH4r/RixwvyeAJjdLS9QV7WQ/tjFTllLA=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw=
github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo= github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo=
github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI=
github.com/stretchr/testify v1.3.1-0.20190311161405-34c6fa2dc709/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.3.1-0.20190311161405-34c6fa2dc709/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI=
github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
@ -382,11 +230,10 @@ github.com/swaggo/files v0.0.0-20220728132757-551d4a08d97a/go.mod h1:lKJPbtWzJ9J
github.com/swaggo/swag v1.8.1/go.mod h1:ugemnJsPZm/kRwFUnzBlbHRd0JY9zE1M4F+uy2pAaPQ= github.com/swaggo/swag v1.8.1/go.mod h1:ugemnJsPZm/kRwFUnzBlbHRd0JY9zE1M4F+uy2pAaPQ=
github.com/swaggo/swag v1.8.7 h1:2K9ivTD3teEO+2fXV6zrZKDqk5IuU2aJtBDo8U7omWU= github.com/swaggo/swag v1.8.7 h1:2K9ivTD3teEO+2fXV6zrZKDqk5IuU2aJtBDo8U7omWU=
github.com/swaggo/swag v1.8.7/go.mod h1:ezQVUUhly8dludpVk+/PuwJWvLLanB13ygV5Pr9enSk= github.com/swaggo/swag v1.8.7/go.mod h1:ezQVUUhly8dludpVk+/PuwJWvLLanB13ygV5Pr9enSk=
github.com/tklauser/go-sysconf v0.3.10 h1:IJ1AZGZRWbY8T5Vfk04D9WOA5WSejdflXxP03OUqALw= github.com/tklauser/go-sysconf v0.3.11 h1:89WgdJhk5SNwJfu+GKyYveZ4IaJ7xAkecBo+KdJV0CM=
github.com/tklauser/go-sysconf v0.3.10/go.mod h1:C8XykCvCb+Gn0oNCWPIlcb0RuglQTYaQ2hGm7jmxEFk= github.com/tklauser/go-sysconf v0.3.11/go.mod h1:GqXfhXY3kiPa0nAXPDIQIWzJbMCB7AmcWpGR8lSZfqI=
github.com/tklauser/numcpus v0.4.0/go.mod h1:1+UI3pD8NW14VMwdgJNJ1ESk2UnwhAnz5hMwiKKqXCQ= github.com/tklauser/numcpus v0.6.0 h1:kebhY2Qt+3U6RNK7UqpYNA+tJ23IBEGKkB7JQBfDYms=
github.com/tklauser/numcpus v0.5.0 h1:ooe7gN0fg6myJ0EKoTAf5hebTZrH52px3New/D9iJ+A= github.com/tklauser/numcpus v0.6.0/go.mod h1:FEZLMke0lhOUG6w2JadTzp0a+Nl8PF/GFkQ5UVIcaL4=
github.com/tklauser/numcpus v0.5.0/go.mod h1:OGzpTxpcIMNGYQdit2BYL1pvk/dSOaJWjKoflh+RQjo=
github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI= github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI=
github.com/urfave/cli/v2 v2.8.1 h1:CGuYNZF9IKZY/rfBe3lJpccSoIY1ytfvmgQT90cNOl4= github.com/urfave/cli/v2 v2.8.1 h1:CGuYNZF9IKZY/rfBe3lJpccSoIY1ytfvmgQT90cNOl4=
github.com/urfave/cli/v2 v2.8.1/go.mod h1:Z41J9TPoffeoqP0Iza0YbAhGvymRdZAd2uPmZ5JxRdY= github.com/urfave/cli/v2 v2.8.1/go.mod h1:Z41J9TPoffeoqP0Iza0YbAhGvymRdZAd2uPmZ5JxRdY=
@ -406,180 +253,69 @@ github.com/xeipuuv/gojsonschema v1.2.0 h1:LhYJRs+L4fBtjZUfuSZIKGeVu0QRy8e5Xi7D17
github.com/xeipuuv/gojsonschema v1.2.0/go.mod h1:anYRn/JVcOK2ZgGU+IjEV4nwlhoK5sQluxsYJ78Id3Y= github.com/xeipuuv/gojsonschema v1.2.0/go.mod h1:anYRn/JVcOK2ZgGU+IjEV4nwlhoK5sQluxsYJ78Id3Y=
github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 h1:bAn7/zixMGCfxrRTfdpNzjtPYqr8smhKouy9mxVdGPU= github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 h1:bAn7/zixMGCfxrRTfdpNzjtPYqr8smhKouy9mxVdGPU=
github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673/go.mod h1:N3UwUGtsrSj3ccvlPHLoLsHnpR27oXr4ZE984MbSER8= github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673/go.mod h1:N3UwUGtsrSj3ccvlPHLoLsHnpR27oXr4ZE984MbSER8=
github.com/yuin/goldmark v1.1.25/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
github.com/yuin/goldmark v1.1.32/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
github.com/yuin/goldmark v1.4.0/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= github.com/yuin/goldmark v1.4.0/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
github.com/yuin/goldmark v1.4.1/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= github.com/yuin/goldmark v1.4.1/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/yusufpapurcu/wmi v1.2.2 h1:KBNDSne4vP5mbSWnJbO+51IMOXJB67QiYCSBrubbPRg= github.com/yusufpapurcu/wmi v1.2.2 h1:KBNDSne4vP5mbSWnJbO+51IMOXJB67QiYCSBrubbPRg=
github.com/yusufpapurcu/wmi v1.2.2/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0= github.com/yusufpapurcu/wmi v1.2.2/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0=
go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU=
go.opencensus.io v0.22.0/go.mod h1:+kGneAE2xo2IficOXnaByMWTGM9T73dGwxeWcUqIpI8=
go.opencensus.io v0.22.2/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw=
go.opencensus.io v0.22.3/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw=
go.opencensus.io v0.22.4/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw=
go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc=
go.uber.org/atomic v1.10.0 h1:9qC72Qh0+3MqyJbAn8YU5xVq1frD8bn3JtD2oXtafVQ= go.uber.org/atomic v1.10.0 h1:9qC72Qh0+3MqyJbAn8YU5xVq1frD8bn3JtD2oXtafVQ=
go.uber.org/atomic v1.10.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0= go.uber.org/atomic v1.10.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0=
go.uber.org/goleak v1.1.11 h1:wy28qYRKZgnJTxGxvye5/wgWr1EKjmUDGYox5mGlRlI=
go.uber.org/goleak v1.1.11/go.mod h1:cwTWslyiVhfpKIDGSZEM2HlOvcqm+tG4zioyIeLoqMQ= go.uber.org/goleak v1.1.11/go.mod h1:cwTWslyiVhfpKIDGSZEM2HlOvcqm+tG4zioyIeLoqMQ=
go.uber.org/goleak v1.1.12 h1:gZAh5/EyT/HQwlpkCy6wTpqfH9H8Lz8zbm3dZh+OyzA=
go.uber.org/goleak v1.1.12/go.mod h1:cwTWslyiVhfpKIDGSZEM2HlOvcqm+tG4zioyIeLoqMQ=
go.uber.org/multierr v1.6.0/go.mod h1:cdWPpRnG4AhwMwsgIHip0KRBQjJy5kYEpYjJxpXp9iU= go.uber.org/multierr v1.6.0/go.mod h1:cdWPpRnG4AhwMwsgIHip0KRBQjJy5kYEpYjJxpXp9iU=
go.uber.org/multierr v1.8.0 h1:dg6GjLku4EH+249NNmoIciG9N/jURbDG+pFlTkhzIC8= go.uber.org/multierr v1.9.0 h1:7fIwc/ZtS0q++VgcfqFDxSBZVv/Xo49/SYnDFupUwlI=
go.uber.org/multierr v1.8.0/go.mod h1:7EAYxJLBy9rStEaz58O2t4Uvip6FSURkq8/ppBp95ak= go.uber.org/multierr v1.9.0/go.mod h1:X2jQV1h+kxSjClGpnseKVIxpmcjrj7MNnI0bnlfKTVQ=
go.uber.org/zap v1.21.0/go.mod h1:wjWOCqI0f2ZZrJF/UufIOkiC8ii6tm1iqIsLo76RfJw= go.uber.org/zap v1.21.0/go.mod h1:wjWOCqI0f2ZZrJF/UufIOkiC8ii6tm1iqIsLo76RfJw=
go.uber.org/zap v1.23.0 h1:OjGQ5KQDEUawVHxNwQgPpiypGHOxo2mNZsOqTak4fFY= go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60=
go.uber.org/zap v1.23.0/go.mod h1:D+nX8jyLsMHMYrln8A0rJjFt/T/9/bGgIhAqxv5URuY= go.uber.org/zap v1.24.0/go.mod h1:2kMP+WWQ8aoFoedH3T2sq6iJ2yDWpHbP0f6MQbS9Gkg=
golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20190510104115-cbcb75029529/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
golang.org/x/crypto v0.0.0-20190605123033-f99c8df09eb5/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
golang.org/x/crypto v0.0.0-20210817164053-32db794688a5/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20210817164053-32db794688a5/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.0.0-20211215153901-e495a2d5b3d3/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= golang.org/x/crypto v0.0.0-20211215153901-e495a2d5b3d3/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
golang.org/x/crypto v0.0.0-20220411220226-7b82a4e95df4/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= golang.org/x/crypto v0.0.0-20220411220226-7b82a4e95df4/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
golang.org/x/crypto v0.1.0 h1:MDRAIl0xIo9Io2xV565hzXHw3zVseKrJKodhohM5CjU=
golang.org/x/crypto v0.1.0/go.mod h1:RecgLatLF4+eUMCP1PoPZQb+cVrJcOPbHkTkbkB9sbw= golang.org/x/crypto v0.1.0/go.mod h1:RecgLatLF4+eUMCP1PoPZQb+cVrJcOPbHkTkbkB9sbw=
golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/crypto v0.5.0 h1:U/0M97KRkSFvyD/3FSmdP5W5swImpNgle/EHFhOsQPE=
golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/crypto v0.5.0/go.mod h1:NK/OQwhpMQP3MwtdjgLlYHnH9ebylxKWv3e0fK+mkQU=
golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8=
golang.org/x/exp v0.0.0-20190829153037-c13cbed26979/go.mod h1:86+5VVa7VpoJ4kLfm080zCjGlMRFzhUhsZKEZO7MGek=
golang.org/x/exp v0.0.0-20191030013958-a1ab85dbe136/go.mod h1:JXzH8nQsPlswgeRAPE3MuO9GYsAcnJvJ4vnMwN/5qkY=
golang.org/x/exp v0.0.0-20191129062945-2f5052295587/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4=
golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4=
golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4=
golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM=
golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU=
golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js=
golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0=
golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
golang.org/x/lint v0.0.0-20190301231843-5614ed5bae6f/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
golang.org/x/lint v0.0.0-20190313153728-d0100b6bd8b3/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
golang.org/x/lint v0.0.0-20190409202823-959b441ac422/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
golang.org/x/lint v0.0.0-20190909230951-414d861bb4ac/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
golang.org/x/lint v0.0.0-20191125180803-fdd1cda4f05f/go.mod h1:5qLYkcX4OjUUV8bRuDixDT3tpyyb+LUpUlRWLxfhWrs=
golang.org/x/lint v0.0.0-20200130185559-910be7a94367/go.mod h1:3xt1FjdF8hUf6vQPIChWIBhFzV8gjjsPE/fR3IyQdNY=
golang.org/x/lint v0.0.0-20200302205851-738671d3881b/go.mod h1:3xt1FjdF8hUf6vQPIChWIBhFzV8gjjsPE/fR3IyQdNY=
golang.org/x/mobile v0.0.0-20190312151609-d3739f865fa6/go.mod h1:z+o9i4GpDbdi3rU15maQ/Ox0txvL9dWGYEHz965HBQE=
golang.org/x/mobile v0.0.0-20190719004257-d2bd2a29d028/go.mod h1:E/iHnbuqvinMTCcRqshq8CkpyQDoeVncDDYHnLhea+o=
golang.org/x/mod v0.0.0-20190513183733-4bf6d317e70e/go.mod h1:mXi4GBBbnImb6dmsKGUJ2LatrhH/nqhxcFungHvyanc=
golang.org/x/mod v0.1.0/go.mod h1:0QHyrYULN0/3qlju5TqG8bIK38QM8yzMo5ekMj3DlcY=
golang.org/x/mod v0.1.1-0.20191105210325-c90efee705ee/go.mod h1:QqPTAvyqsEbceGzBzNggFXnrqF1CaUcvgkdR5Ot7KZg=
golang.org/x/mod v0.1.1-0.20191107180719-034126e5016b/go.mod h1:QqPTAvyqsEbceGzBzNggFXnrqF1CaUcvgkdR5Ot7KZg=
golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
golang.org/x/mod v0.6.0-dev.0.20220106191415-9b9b3d81d5e3/go.mod h1:3p9vT2HGsQu2K1YbXdKPJLVgG5VJdoTa1poYQBtP1AY= golang.org/x/mod v0.6.0-dev.0.20220106191415-9b9b3d81d5e3/go.mod h1:3p9vT2HGsQu2K1YbXdKPJLVgG5VJdoTa1poYQBtP1AY=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.6.0 h1:b9gGHsz9/HhJ3HF5DHQytPpuwocVTChQJK3AvoLRD5I= golang.org/x/mod v0.7.0 h1:LapD9S96VoQRhi/GrNTqeBJFrUjs5UHCAtTlgwA5oZA=
golang.org/x/mod v0.6.0/go.mod h1:4mET923SAdbXp2ki8ey+zGs1SLqsuM2Y0uvdZR/fUNI= golang.org/x/mod v0.7.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20190108225652-1e06a53dbb7e/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20190213061140-3a22650c66bd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
golang.org/x/net v0.0.0-20190501004415-9ce7a6920f09/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
golang.org/x/net v0.0.0-20190503192946-f4e77d36d62c/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
golang.org/x/net v0.0.0-20190603091049-60506f45cf65/go.mod h1:HSz+uSET+XFnRR8LxR5pz3Of3rY3CfYBVs4xY44aLks=
golang.org/x/net v0.0.0-20190613194153-d28f0bde5980/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20190628185345-da137c7871d7/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20190724013045-ca1201d0de80/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20191209160850-c0dbc17a3553/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200114155413-6afb5195e5aa/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200202094626-16171245cfb2/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200222125558-5a598a2470a0/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200226121028-0de0cce0169b/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200301022130-244492dfa37a/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20200324143707-d3edc9973b7e/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A=
golang.org/x/net v0.0.0-20200501053045-e0ff5e5a1de5/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A=
golang.org/x/net v0.0.0-20200506145744-7e3656a0809f/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A=
golang.org/x/net v0.0.0-20200513185701-a91f0712d120/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A=
golang.org/x/net v0.0.0-20200520182314-0ba52f642ac2/go.mod h1:qpuaurCH72eLCgpAm/N6yyVIVM9cpaDIP3A8BGJEC5A=
golang.org/x/net v0.0.0-20200625001655-4c5254603344/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA=
golang.org/x/net v0.0.0-20200707034311-ab3426394381/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA=
golang.org/x/net v0.0.0-20200822124328-c89045814202/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg= golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM= golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM=
golang.org/x/net v0.0.0-20210421230115-4e50805a0758/go.mod h1:72T/g9IO56b78aLF+1Kcs5dz7/ng1VjMUvfKvpfy+jM= golang.org/x/net v0.0.0-20210421230115-4e50805a0758/go.mod h1:72T/g9IO56b78aLF+1Kcs5dz7/ng1VjMUvfKvpfy+jM=
golang.org/x/net v0.0.0-20210525063256-abc453219eb5/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20210726213435-c6fcb2dbf985/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20210726213435-c6fcb2dbf985/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20210805182204-aaa1db679c0d/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20210805182204-aaa1db679c0d/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20211015210444-4f30a5c0130f/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20211015210444-4f30a5c0130f/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk=
golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk=
golang.org/x/net v0.0.0-20220425223048-2871e0cb64e4/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220425223048-2871e0cb64e4/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk=
golang.org/x/net v0.0.0-20220630215102-69896b714898/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.0.0-20220630215102-69896b714898/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.1.0 h1:hZ/3BUoy5aId7sCpA/Tc5lt8DkFgdVS2onTpJsZ/fl0=
golang.org/x/net v0.1.0/go.mod h1:Cx3nUiGt4eDBEyega/BKRp+/AlGL8hYe7U9odMt2Cco= golang.org/x/net v0.1.0/go.mod h1:Cx3nUiGt4eDBEyega/BKRp+/AlGL8hYe7U9odMt2Cco=
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/net v0.5.0 h1:GyT4nK/YDHSqa1c4753ouYCDajOYKTja9Xb/OHtgvSw=
golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/net v0.5.0/go.mod h1:DivGGAXEgPSlEBzxGzZI+ZLohi+xUj054jfeKui00ws=
golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
golang.org/x/oauth2 v0.0.0-20191202225959-858c2ad4c8b6/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
golang.org/x/oauth2 v0.0.0-20200107190931-bf48bf16ab8d/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
golang.org/x/oauth2 v0.0.0-20210514164344-f6687ab2804c/go.mod h1:KelEdhl1UZF7XfJ4dDtk6s++YSgaE7mD/BuKKDLBl4A=
golang.org/x/oauth2 v0.0.0-20220223155221-ee480838109b/go.mod h1:DAh4E804XQdzx2j+YRIaUnCqCV2RuMz24cGBJ5QYIrc=
golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20190227155943-e225da77a7e6/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20200317015054-43a5402ce75a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20200625203802-6e8e738ad208/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20201207232520-09787c993a3a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4 h1:uVc8UZUe6tr40fFVnUP5Oj+veunVezqYl9z7DYw9xzw=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sync v0.1.0 h1:wsuoTGHzEhffawBOhz5CYhcrV4IdKZbEyZjBMuTp12o=
golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20190312061237-fead79001313/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190422165155-953cdadca894/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190502145724-3ef323f4f1fd/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190507160741-ecd444e8653b/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190606165138-5da285871e9c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190624142023-c5567b49c5d0/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190726091711-fc99dfbffb4e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20190916202348-b4ddaad3f8a3/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190916202348-b4ddaad3f8a3/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20191001151750-bb3f8db39f24/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20191204072324-ce4227a45e2e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20191228213918-04cbcbbfeed8/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200106162015-b016eb3dc98e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200113162924-86b910548bc1/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200122134326-e047566fdf82/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200202164722-d101bd2416d5/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200212091648-12a6c2dcc1e4/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200223170610-d5e6a3e2c0ae/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200302150141-5c8b2ff67527/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200323222414-85ca7c5b95cd/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200331124033-c3d80250170d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200501052902-10377860bb8e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200511232937-7e40ca221e25/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200515095857-1151b9dac4a9/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200523222454-059865788121/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200615200032-f1bc736245b1/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200625212154-ddb9806d33ae/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200803210538-64077c9b5642/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20201204225414-ed752295db88/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201204225414-ed752295db88/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210330210617-4fbd30eecc44/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210330210617-4fbd30eecc44/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210420072515-93ed5bcd2bfe/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210420072515-93ed5bcd2bfe/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210510120138-977fb7262007/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210510120138-977fb7262007/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20210603081109-ebe580a85c40/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20210806184541-e5e7981a1069/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210806184541-e5e7981a1069/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
@ -588,166 +324,49 @@ golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBc
golang.org/x/sys v0.0.0-20211019181941-9d821ace8654/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211019181941-9d821ace8654/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20211103235746-7861aae1554b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211103235746-7861aae1554b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220114195835-da31bd327af9/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220128215802-99c3d69c2c27/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220422013727-9388b58f7150/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220422013727-9388b58f7150/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.1.0 h1:kunALQeHf1/185U1i0GOB/fy1IPRDDpuoOOqRReG57U=
golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.4.0 h1:Zr2JFtRQNX3BCZ8YtxRE9hNJYC8J6I1MVbMg6owUp18=
golang.org/x/sys v0.4.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.1.0/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.1.0/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.4.0 h1:BrVqGRd7+k1DiOgtnFvAkoQEWQvBc25ouMJM6429SFg=
golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/text v0.6.0 h1:3XmdazWV+ubf7QgHSTWeykHOci5oeekaGJBLkrkaw4k=
golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/text v0.6.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
golang.org/x/time v0.0.0-20201208040808-7e3f01d25324/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20201208040808-7e3f01d25324/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
golang.org/x/time v0.1.0 h1:xYY+Bajn2a7VBmTM5GikTmnK8ZuX8YgnQCqZpbBNtmA= golang.org/x/time v0.3.0 h1:rg5rLMjNzMS1RkNLzCG38eapWhnYLFYXDXj2gOlr8j4=
golang.org/x/time v0.1.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.3.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20190114222345-bf090417da8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20190226205152-f727befe758c/go.mod h1:9Yl7xja0Znq3iFh3HoIrodX9oNMXvdceNzlUR8zjMvY=
golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs=
golang.org/x/tools v0.0.0-20190312151545-0bb0c0a6e846/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs=
golang.org/x/tools v0.0.0-20190312170243-e65039ee4138/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs=
golang.org/x/tools v0.0.0-20190328211700-ab21143f2384/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= golang.org/x/tools v0.0.0-20190328211700-ab21143f2384/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs=
golang.org/x/tools v0.0.0-20190425150028-36563e24a262/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q=
golang.org/x/tools v0.0.0-20190506145303-2d16b83fe98c/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q=
golang.org/x/tools v0.0.0-20190524140312-2c0ae7006135/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q=
golang.org/x/tools v0.0.0-20190606124116-d0a3d012864b/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc=
golang.org/x/tools v0.0.0-20190621195816-6e04913cbbac/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc=
golang.org/x/tools v0.0.0-20190628153133-6cdbf07be9d0/go.mod h1:/rFqwRUd4F7ZHNgwSSTFct+R/Kf4OFW1sUzUTQQTgfc=
golang.org/x/tools v0.0.0-20190816200558-6889da9d5479/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20190911174233-4f2ddba30aff/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191012152004-8de300cfc20a/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191113191852-77e3bb0ad9e7/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191115202509-3a792d9c32b2/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191125144606-a911d9008d1f/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191130070609-6e064ea0cf2d/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.0.0-20191216173652-a0e659d51361/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20191227053925-7b8e75db28f4/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200117161641-43d50277825c/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200122220014-bf1340f18c4a/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200130002326-2f3ba24bd6e7/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200204074204-1cc6d1ef6c74/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200207183749-b753a1ba74fa/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200212150539-ea181f53ac56/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200224181240-023911ca70b2/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200227222343-706bc42d1f0d/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
golang.org/x/tools v0.0.0-20200304193943-95d2e580d8eb/go.mod h1:o4KQGtdN14AW+yjsvvwRTJJuXz8XRtIHtEnmAXLyFUw=
golang.org/x/tools v0.0.0-20200312045724-11d5b4c81c7d/go.mod h1:o4KQGtdN14AW+yjsvvwRTJJuXz8XRtIHtEnmAXLyFUw=
golang.org/x/tools v0.0.0-20200331025713-a30bf2db82d4/go.mod h1:Sl4aGygMT6LrqrWclx+PTx3U+LnKx/seiNR+3G19Ar8=
golang.org/x/tools v0.0.0-20200501065659-ab2804fb9c9d/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
golang.org/x/tools v0.0.0-20200512131952-2bc93b1c0c88/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
golang.org/x/tools v0.0.0-20200515010526-7d3b6ebf133d/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
golang.org/x/tools v0.0.0-20200618134242-20370b0cb4b2/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
golang.org/x/tools v0.0.0-20200729194436-6467de6f59a7/go.mod h1:njjCfa9FT2d7l9Bc6FUM5FLjQPp3cFF28FI3qnDFljA=
golang.org/x/tools v0.0.0-20200804011535-6c149bb5ef0d/go.mod h1:njjCfa9FT2d7l9Bc6FUM5FLjQPp3cFF28FI3qnDFljA=
golang.org/x/tools v0.0.0-20200825202427-b303f430e36d/go.mod h1:njjCfa9FT2d7l9Bc6FUM5FLjQPp3cFF28FI3qnDFljA=
golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
golang.org/x/tools v0.1.6-0.20210726203631-07bc1bf47fb2/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.6-0.20210726203631-07bc1bf47fb2/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
golang.org/x/tools v0.1.7/go.mod h1:LGqMHiF4EqQNHR1JncWGqT5BVaXmza+X+BDGol+dOxo= golang.org/x/tools v0.1.7/go.mod h1:LGqMHiF4EqQNHR1JncWGqT5BVaXmza+X+BDGol+dOxo=
golang.org/x/tools v0.1.10/go.mod h1:Uh6Zz+xoGYZom868N8YTex3t7RhtHDBrE8Gzo9bV56E= golang.org/x/tools v0.1.10/go.mod h1:Uh6Zz+xoGYZom868N8YTex3t7RhtHDBrE8Gzo9bV56E=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.2.0 h1:G6AHpWxTMGY1KyEYoAQ5WTtIekUUvDNjan3ugu60JvE= golang.org/x/tools v0.4.0 h1:7mTAgkunk3fr4GAloyyCasadO6h9zSsQZbwvcaIciV4=
golang.org/x/tools v0.2.0/go.mod h1:y4OqIKeOV/fWJetJ8bXPU1sEVniLMIyDAZWeHdV+NTA= golang.org/x/tools v0.4.0/go.mod h1:UE5sM2OK9E/d67R0ANs2xJizIymRP5gJU295PvKXxjQ=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
google.golang.org/api v0.4.0/go.mod h1:8k5glujaEP+g9n7WNsDg8QP6cUVNI86fCNMcbazEtwE=
google.golang.org/api v0.7.0/go.mod h1:WtwebWUNSVBH/HAw79HIFXZNqEvBhG+Ra+ax0hx3E3M=
google.golang.org/api v0.8.0/go.mod h1:o4eAsZoiT+ibD93RtjEohWalFOjRDx6CVaqeizhEnKg=
google.golang.org/api v0.9.0/go.mod h1:o4eAsZoiT+ibD93RtjEohWalFOjRDx6CVaqeizhEnKg=
google.golang.org/api v0.13.0/go.mod h1:iLdEw5Ide6rF15KTC1Kkl0iskquN2gFfn9o9XIsbkAI=
google.golang.org/api v0.14.0/go.mod h1:iLdEw5Ide6rF15KTC1Kkl0iskquN2gFfn9o9XIsbkAI=
google.golang.org/api v0.15.0/go.mod h1:iLdEw5Ide6rF15KTC1Kkl0iskquN2gFfn9o9XIsbkAI=
google.golang.org/api v0.17.0/go.mod h1:BwFmGc8tA3vsd7r/7kR8DY7iEEGSU04BFxCo5jP/sfE=
google.golang.org/api v0.18.0/go.mod h1:BwFmGc8tA3vsd7r/7kR8DY7iEEGSU04BFxCo5jP/sfE=
google.golang.org/api v0.19.0/go.mod h1:BwFmGc8tA3vsd7r/7kR8DY7iEEGSU04BFxCo5jP/sfE=
google.golang.org/api v0.20.0/go.mod h1:BwFmGc8tA3vsd7r/7kR8DY7iEEGSU04BFxCo5jP/sfE=
google.golang.org/api v0.22.0/go.mod h1:BwFmGc8tA3vsd7r/7kR8DY7iEEGSU04BFxCo5jP/sfE=
google.golang.org/api v0.24.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0MncE=
google.golang.org/api v0.28.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0MncE=
google.golang.org/api v0.29.0/go.mod h1:Lcubydp8VUV7KeIHD9z2Bys/sm/vGKnG1UHuDBSrHWM=
google.golang.org/api v0.30.0/go.mod h1:QGmEvQ87FHZNiUVJkT14jQNYJ4ZJjdRF23ZXz5138Fc=
google.golang.org/appengine v1.1.0/go.mod h1:EbEs0AVv82hx2wNQdGPgUI5lhzA/G0D9YwlJXL52JkM=
google.golang.org/appengine v1.4.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4=
google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4=
google.golang.org/appengine v1.6.1/go.mod h1:i06prIuMbXzDqacNJfV5OdTW448YApPu5ww/cMBSeb0=
google.golang.org/appengine v1.6.5/go.mod h1:8WjMMxjGQR8xUklV/ARdw2HLXBOI7O7uCIDZVag1xfc=
google.golang.org/appengine v1.6.6/go.mod h1:8WjMMxjGQR8xUklV/ARdw2HLXBOI7O7uCIDZVag1xfc=
google.golang.org/genproto v0.0.0-20180817151627-c66870c02cf8/go.mod h1:JiN7NxoALGmiZfu7CAH4rXhgtRTLTxftemlI0sWmxmc=
google.golang.org/genproto v0.0.0-20190307195333-5fe7a883aa19/go.mod h1:VzzqZJRnGkLBvHegQrXjBqPurQTc5/KpmUdxsrq26oE=
google.golang.org/genproto v0.0.0-20190418145605-e7d98fc518a7/go.mod h1:VzzqZJRnGkLBvHegQrXjBqPurQTc5/KpmUdxsrq26oE=
google.golang.org/genproto v0.0.0-20190425155659-357c62f0e4bb/go.mod h1:VzzqZJRnGkLBvHegQrXjBqPurQTc5/KpmUdxsrq26oE=
google.golang.org/genproto v0.0.0-20190502173448-54afdca5d873/go.mod h1:VzzqZJRnGkLBvHegQrXjBqPurQTc5/KpmUdxsrq26oE=
google.golang.org/genproto v0.0.0-20190801165951-fa694d86fc64/go.mod h1:DMBHOl98Agz4BDEuKkezgsaosCRResVns1a3J2ZsMNc=
google.golang.org/genproto v0.0.0-20190819201941-24fa4b261c55/go.mod h1:DMBHOl98Agz4BDEuKkezgsaosCRResVns1a3J2ZsMNc=
google.golang.org/genproto v0.0.0-20190911173649-1774047e7e51/go.mod h1:IbNlFCBrqXvoKpeg0TB2l7cyZUmoaFKYIwrEpbDKLA8=
google.golang.org/genproto v0.0.0-20191108220845-16a3f7862a1a/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20191115194625-c23dd37a84c9/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20191216164720-4f79533eabd1/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20191230161307-f3c370f40bfb/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20200115191322-ca5a22157cba/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20200122232147-0452cf42e150/go.mod h1:n3cpQtvxv34hfy77yVDNjmbRyujviMdxYliBSkLhpCc=
google.golang.org/genproto v0.0.0-20200204135345-fa8e72b47b90/go.mod h1:GmwEX6Z4W5gMy59cAlVYjN9JhxgbQH6Gn+gFDQe2lzA=
google.golang.org/genproto v0.0.0-20200212174721-66ed5ce911ce/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200224152610-e50cd9704f63/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200228133532-8c2c7df3a383/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200305110556-506484158171/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200312145019-da6875a35672/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200331122359-1ee6d9798940/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200430143042-b979b6f78d84/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200511104702-f5ebc3bea380/go.mod h1:55QSHmfGQM9UVYDPBsyGGes0y52j32PQ3BqQfXhyH3c=
google.golang.org/genproto v0.0.0-20200515170657-fc4c6c6a6587/go.mod h1:YsZOwe1myG/8QRHRsmBRE1LrgQY60beZKjly0O1fX9U=
google.golang.org/genproto v0.0.0-20200526211855-cb27e3aa2013/go.mod h1:NbSheEEYHJ7i3ixzK3sjbqSGDJWnxyFXZblF3eUsNvo=
google.golang.org/genproto v0.0.0-20200618031413-b414f8b61790/go.mod h1:jDfRM7FcilCzHH/e9qn6dsT145K34l5v+OpcnNgKAAA=
google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c=
google.golang.org/grpc v1.20.1/go.mod h1:10oTOabMzJvdu6/UiuZezV6QK5dSlG84ov/aaiqXj38=
google.golang.org/grpc v1.21.1/go.mod h1:oYelfM1adQP15Ek0mdvEgi9Df8B9CZIaU1084ijfRaM=
google.golang.org/grpc v1.23.0/go.mod h1:Y5yQAOtifL1yxbo5wqy6BxZv8vAUGQwXBOALyacEbxg=
google.golang.org/grpc v1.25.1/go.mod h1:c3i+UQWmh7LiEpx4sFZnkU36qjEYZ0imhYfXVyQciAY=
google.golang.org/grpc v1.26.0/go.mod h1:qbnxyOmOxrQa7FizSgH+ReBfzJrCY1pSN7KXBS8abTk=
google.golang.org/grpc v1.27.0/go.mod h1:qbnxyOmOxrQa7FizSgH+ReBfzJrCY1pSN7KXBS8abTk=
google.golang.org/grpc v1.27.1/go.mod h1:qbnxyOmOxrQa7FizSgH+ReBfzJrCY1pSN7KXBS8abTk=
google.golang.org/grpc v1.28.0/go.mod h1:rpkK4SK4GF4Ach/+MFLZUBavHOvF2JJB5uozKKal+60=
google.golang.org/grpc v1.29.1/go.mod h1:itym6AZVZYACWQqET3MqgPpjcuV5QH3BxFS3IjizoKk=
google.golang.org/grpc v1.30.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
google.golang.org/grpc v1.31.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0=
google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM=
google.golang.org/protobuf v1.20.1-0.20200309200217-e05f789c0967/go.mod h1:A+miEFZTKqfCUM6K7xSMQL9OKL/b6hQv+e19PK+JZNE=
google.golang.org/protobuf v1.21.0/go.mod h1:47Nbq4nVaFHyn7ilMalzfO3qCViNmqZ2kzikPIcrTAo=
google.golang.org/protobuf v1.22.0/go.mod h1:EGpADcykh3NcUnDUJcl1+ZksZNG86OlYog2l/sGQquU=
google.golang.org/protobuf v1.23.0/go.mod h1:EGpADcykh3NcUnDUJcl1+ZksZNG86OlYog2l/sGQquU=
google.golang.org/protobuf v1.23.1-0.20200526195155-81db48ad09cc/go.mod h1:EGpADcykh3NcUnDUJcl1+ZksZNG86OlYog2l/sGQquU=
google.golang.org/protobuf v1.24.0/go.mod h1:r/3tXBNzIEhYS9I1OUVjXDlt8tc493IdKGjtUeSXeh4=
google.golang.org/protobuf v1.25.0/go.mod h1:9JNX74DMeImyA3h4bdi1ymwjUzf21/xIlbajtzgsN7c=
google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw=
google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
google.golang.org/protobuf v1.28.1 h1:d0NfwRgPtno5B1Wa6L2DAG+KivqkdutMf1UhdNx175w= google.golang.org/protobuf v1.28.1 h1:d0NfwRgPtno5B1Wa6L2DAG+KivqkdutMf1UhdNx175w=
google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
@ -755,15 +374,12 @@ gopkg.in/check.v1 v1.0.0-20200227125254-8fa46927fb4f/go.mod h1:Co6ibVJAznAaIkqp8
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI= gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI=
gopkg.in/ini.v1 v1.66.6 h1:LATuAqN/shcYAOkv3wl2L4rkaKqkcgTBQjOyYDvcPKI= gopkg.in/ini.v1 v1.67.0 h1:Dgnx+6+nfE+IfzjUEISNeydPJh9AXNNsWbGP9KzCsOA=
gopkg.in/ini.v1 v1.66.6/go.mod h1:pNLf8WUiyNEtQjuu5G5vTm06TEv9tsIgeAvK8hOrP4k= gopkg.in/ini.v1 v1.67.0/go.mod h1:pNLf8WUiyNEtQjuu5G5vTm06TEv9tsIgeAvK8hOrP4k=
gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.3/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.3/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.5/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.3.0/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY= gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY=
gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ= gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
@ -771,13 +387,3 @@ gopkg.in/yaml.v3 v3.0.0-20200615113413-eeeca48fe776/go.mod h1:K4uyk7z7BCEPqu6E+C
gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
honnef.co/go/tools v0.0.0-20190102054323-c2f93a96b099/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4=
honnef.co/go/tools v0.0.0-20190106161140-3f1c8253044a/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4=
honnef.co/go/tools v0.0.0-20190418001031-e561f6794a2a/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4=
honnef.co/go/tools v0.0.0-20190523083050-ea95bdfd59fc/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4=
honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg=
honnef.co/go/tools v0.0.1-2020.1.3/go.mod h1:X/FiERA/W4tHapMX5mGpAtMSVEeEUOyHaw9vFzvIQ3k=
honnef.co/go/tools v0.0.1-2020.1.4/go.mod h1:X/FiERA/W4tHapMX5mGpAtMSVEeEUOyHaw9vFzvIQ3k=
rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8=
rsc.io/quote/v3 v3.1.0/go.mod h1:yEA65RcK8LyAZtP9Kv3t0HmxON59tX3rD+tICJqUlj0=
rsc.io/sampler v1.3.0/go.mod h1:T1hPZKmBbMNahiBKFy5HrXp6adAjACjK9JXDnKaTXpA=

View file

@ -10,14 +10,19 @@ import (
"github.com/datarhei/core/v16/config/store" "github.com/datarhei/core/v16/config/store"
v1 "github.com/datarhei/core/v16/config/v1" v1 "github.com/datarhei/core/v16/config/v1"
"github.com/datarhei/core/v16/http/mock" "github.com/datarhei/core/v16/http/mock"
"github.com/datarhei/core/v16/io/fs"
"github.com/labstack/echo/v4" "github.com/labstack/echo/v4"
"github.com/stretchr/testify/require" "github.com/stretchr/testify/require"
) )
func getDummyConfigRouter() (*echo.Echo, store.Store) { func getDummyConfigRouter(t *testing.T) (*echo.Echo, store.Store) {
router := mock.DummyEcho() router := mock.DummyEcho()
config := store.NewDummy() memfs, err := fs.NewMemFilesystem(fs.MemConfig{})
require.NoError(t, err)
config, err := store.NewJSON(memfs, "/config.json", nil)
require.NoError(t, err)
handler := NewConfig(config) handler := NewConfig(config)
@ -28,7 +33,7 @@ func getDummyConfigRouter() (*echo.Echo, store.Store) {
} }
func TestConfigGet(t *testing.T) { func TestConfigGet(t *testing.T) {
router, _ := getDummyConfigRouter() router, _ := getDummyConfigRouter(t)
mock.Request(t, http.StatusOK, router, "GET", "/", nil) mock.Request(t, http.StatusOK, router, "GET", "/", nil)
@ -36,18 +41,18 @@ func TestConfigGet(t *testing.T) {
} }
func TestConfigSetConflict(t *testing.T) { func TestConfigSetConflict(t *testing.T) {
router, _ := getDummyConfigRouter() router, _ := getDummyConfigRouter(t)
var data bytes.Buffer var data bytes.Buffer
encoder := json.NewEncoder(&data) encoder := json.NewEncoder(&data)
encoder.Encode(config.New()) encoder.Encode(config.New(nil))
mock.Request(t, http.StatusConflict, router, "PUT", "/", &data) mock.Request(t, http.StatusConflict, router, "PUT", "/", &data)
} }
func TestConfigSet(t *testing.T) { func TestConfigSet(t *testing.T) {
router, store := getDummyConfigRouter() router, store := getDummyConfigRouter(t)
storedcfg := store.Get() storedcfg := store.Get()
@ -57,7 +62,7 @@ func TestConfigSet(t *testing.T) {
encoder := json.NewEncoder(&data) encoder := json.NewEncoder(&data)
// Setting a new v3 config // Setting a new v3 config
cfg := config.New() cfg := config.New(nil)
cfg.FFmpeg.Binary = "true" cfg.FFmpeg.Binary = "true"
cfg.DB.Dir = "." cfg.DB.Dir = "."
cfg.Storage.Disk.Dir = "." cfg.Storage.Disk.Dir = "."
@ -78,7 +83,7 @@ func TestConfigSet(t *testing.T) {
require.Equal(t, "cert@datarhei.com", cfg.TLS.Email) require.Equal(t, "cert@datarhei.com", cfg.TLS.Email)
// Setting a complete v1 config // Setting a complete v1 config
cfgv1 := v1.New() cfgv1 := v1.New(nil)
cfgv1.FFmpeg.Binary = "true" cfgv1.FFmpeg.Binary = "true"
cfgv1.DB.Dir = "." cfgv1.DB.Dir = "."
cfgv1.Storage.Disk.Dir = "." cfgv1.Storage.Disk.Dir = "."

View file

@ -82,7 +82,7 @@ func (h *FSHandler) PutFile(c echo.Context) error {
req := c.Request() req := c.Request()
_, created, err := h.fs.Filesystem.Store(path, req.Body) _, created, err := h.fs.Filesystem.WriteFileReader(path, req.Body)
if err != nil { if err != nil {
return api.Err(http.StatusBadRequest, "%s", err) return api.Err(http.StatusBadRequest, "%s", err)
} }
@ -105,7 +105,7 @@ func (h *FSHandler) DeleteFile(c echo.Context) error {
c.Response().Header().Del(echo.HeaderContentType) c.Response().Header().Del(echo.HeaderContentType)
size := h.fs.Filesystem.Delete(path) size := h.fs.Filesystem.Remove(path)
if size < 0 { if size < 0 {
return api.Err(http.StatusNotFound, "File not found", path) return api.Err(http.StatusNotFound, "File not found", path)
@ -123,7 +123,7 @@ func (h *FSHandler) ListFiles(c echo.Context) error {
sortby := util.DefaultQuery(c, "sort", "none") sortby := util.DefaultQuery(c, "sort", "none")
order := util.DefaultQuery(c, "order", "asc") order := util.DefaultQuery(c, "order", "asc")
files := h.fs.Filesystem.List(pattern) files := h.fs.Filesystem.List("/", pattern)
var sortFunc func(i, j int) bool var sortFunc func(i, j int) bool

View file

@ -17,6 +17,7 @@ import (
"github.com/datarhei/core/v16/http/errorhandler" "github.com/datarhei/core/v16/http/errorhandler"
"github.com/datarhei/core/v16/http/validator" "github.com/datarhei/core/v16/http/validator"
"github.com/datarhei/core/v16/internal/testhelper" "github.com/datarhei/core/v16/internal/testhelper"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/restream" "github.com/datarhei/core/v16/restream"
"github.com/datarhei/core/v16/restream/store" "github.com/datarhei/core/v16/restream/store"
@ -32,7 +33,17 @@ func DummyRestreamer(pathPrefix string) (restream.Restreamer, error) {
return nil, fmt.Errorf("failed to build helper program: %w", err) return nil, fmt.Errorf("failed to build helper program: %w", err)
} }
store := store.NewDummyStore(store.DummyConfig{}) memfs, err := fs.NewMemFilesystem(fs.MemConfig{})
if err != nil {
return nil, fmt.Errorf("failed to create memory filesystem: %w", err)
}
store, err := store.NewJSON(store.JSONConfig{
Filesystem: memfs,
})
if err != nil {
return nil, err
}
ffmpeg, err := ffmpeg.New(ffmpeg.Config{ ffmpeg, err := ffmpeg.New(ffmpeg.Config{
Binary: binary, Binary: binary,

View file

@ -198,7 +198,7 @@ func NewServer(config Config) (Server, error) {
if fs.Filesystem.Type() == "disk" { if fs.Filesystem.Type() == "disk" {
s.middleware.hlsrewrite = mwhlsrewrite.NewHLSRewriteWithConfig(mwhlsrewrite.HLSRewriteConfig{ s.middleware.hlsrewrite = mwhlsrewrite.NewHLSRewriteWithConfig(mwhlsrewrite.HLSRewriteConfig{
PathPrefix: fs.Filesystem.Base(), PathPrefix: fs.Filesystem.Metadata("base"),
}) })
} }
} }

View file

@ -1,28 +1,30 @@
package fs package fs
import ( import (
"bytes"
"fmt" "fmt"
"io" "io"
"io/fs"
"os" "os"
"path/filepath" "path/filepath"
"strings" "strings"
"sync"
"time" "time"
"github.com/datarhei/core/v16/glob" "github.com/datarhei/core/v16/glob"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
) )
// DiskConfig is the config required to create a new disk // DiskConfig is the config required to create a new disk filesystem.
// filesystem.
type DiskConfig struct { type DiskConfig struct {
// Namee is the name of the filesystem // For logging, optional
Name string Logger log.Logger
}
// Dir is the path to the directory to observe // RootedDiskConfig is the config required to create a new rooted disk filesystem.
Dir string type RootedDiskConfig struct {
// Root is the path this filesystem is rooted to
// Size of the filesystem in bytes Root string
Size int64
// For logging, optional // For logging, optional
Logger log.Logger Logger log.Logger
@ -30,8 +32,9 @@ type DiskConfig struct {
// diskFileInfo implements the FileInfo interface // diskFileInfo implements the FileInfo interface
type diskFileInfo struct { type diskFileInfo struct {
dir string root string
name string name string
mode os.FileMode
finfo os.FileInfo finfo os.FileInfo
} }
@ -40,31 +43,37 @@ func (fi *diskFileInfo) Name() string {
} }
func (fi *diskFileInfo) Size() int64 { func (fi *diskFileInfo) Size() int64 {
if fi.finfo.IsDir() {
return 0
}
return fi.finfo.Size() return fi.finfo.Size()
} }
func (fi *diskFileInfo) Mode() fs.FileMode {
return fi.mode
}
func (fi *diskFileInfo) ModTime() time.Time { func (fi *diskFileInfo) ModTime() time.Time {
return fi.finfo.ModTime() return fi.finfo.ModTime()
} }
func (fi *diskFileInfo) IsLink() (string, bool) { func (fi *diskFileInfo) IsLink() (string, bool) {
mode := fi.finfo.Mode() if fi.mode&os.ModeSymlink == 0 {
if mode&os.ModeSymlink == 0 {
return fi.name, false return fi.name, false
} }
path, err := os.Readlink(filepath.Join(fi.dir, fi.name)) path, err := os.Readlink(filepath.Join(fi.root, fi.name))
if err != nil { if err != nil {
return fi.name, false return fi.name, false
} }
path = filepath.Join(fi.dir, path) if !strings.HasPrefix(path, fi.root) {
if !strings.HasPrefix(path, fi.dir) {
return fi.name, false return fi.name, false
} }
name := strings.TrimPrefix(path, fi.dir) name := strings.TrimPrefix(path, fi.root)
if name[0] != os.PathSeparator { if name[0] != os.PathSeparator {
name = string(os.PathSeparator) + name name = string(os.PathSeparator) + name
} }
@ -78,8 +87,9 @@ func (fi *diskFileInfo) IsDir() bool {
// diskFile implements the File interface // diskFile implements the File interface
type diskFile struct { type diskFile struct {
dir string root string
name string name string
mode os.FileMode
file *os.File file *os.File
} }
@ -94,8 +104,9 @@ func (f *diskFile) Stat() (FileInfo, error) {
} }
dif := &diskFileInfo{ dif := &diskFileInfo{
dir: f.dir, root: f.root,
name: f.name, name: f.name,
mode: f.mode,
finfo: finfo, finfo: finfo,
} }
@ -112,12 +123,11 @@ func (f *diskFile) Read(p []byte) (int, error) {
// diskFilesystem implements the Filesystem interface // diskFilesystem implements the Filesystem interface
type diskFilesystem struct { type diskFilesystem struct {
name string metadata map[string]string
dir string lock sync.RWMutex
// Max. size of the filesystem in bytes as root string
// given by the config cwd string
maxSize int64
// Current size of the filesystem in bytes // Current size of the filesystem in bytes
currentSize int64 currentSize int64
@ -127,67 +137,102 @@ type diskFilesystem struct {
logger log.Logger logger log.Logger
} }
// NewDiskFilesystem returns a new filesystem that is backed by a disk // NewDiskFilesystem returns a new filesystem that is backed by the disk filesystem.
// that implements the Filesystem interface // The root is / and the working directory is whatever is returned by os.Getwd(). The value
// of Root in the config will be ignored.
func NewDiskFilesystem(config DiskConfig) (Filesystem, error) { func NewDiskFilesystem(config DiskConfig) (Filesystem, error) {
fs := &diskFilesystem{ fs := &diskFilesystem{
name: config.Name, metadata: make(map[string]string),
maxSize: config.Size, root: "/",
cwd: "/",
logger: config.Logger, logger: config.Logger,
} }
cwd, err := os.Getwd()
if err != nil {
return nil, err
}
fs.cwd = cwd
if len(fs.cwd) == 0 {
fs.cwd = "/"
}
fs.cwd = filepath.Clean(fs.cwd)
if !filepath.IsAbs(fs.cwd) {
return nil, fmt.Errorf("the current working directory must be an absolute path")
}
if fs.logger == nil { if fs.logger == nil {
fs.logger = log.New("") fs.logger = log.New("")
} }
fs.logger = fs.logger.WithFields(log.Fields{ return fs, nil
"name": fs.name, }
"type": "disk",
})
if err := fs.Rebase(config.Dir); err != nil { // NewRootedDiskFilesystem returns a filesystem that is backed by the disk filesystem. The
// root of the filesystem is defined by DiskConfig.Root. The working directory is "/". Root
// must be directory. If it doesn't exist, it will be created
func NewRootedDiskFilesystem(config RootedDiskConfig) (Filesystem, error) {
fs := &diskFilesystem{
metadata: make(map[string]string),
root: config.Root,
cwd: "/",
logger: config.Logger,
}
if len(fs.root) == 0 {
fs.root = "/"
}
if root, err := filepath.Abs(fs.root); err != nil {
return nil, err return nil, err
} else {
fs.root = root
}
err := os.MkdirAll(fs.root, 0700)
if err != nil {
return nil, err
}
info, err := os.Stat(fs.root)
if err != nil {
return nil, err
}
if !info.IsDir() {
return nil, fmt.Errorf("root is not a directory")
}
if fs.logger == nil {
fs.logger = log.New("")
} }
return fs, nil return fs, nil
} }
func (fs *diskFilesystem) Name() string { func (fs *diskFilesystem) Name() string {
return fs.name return "disk"
}
func (fs *diskFilesystem) Base() string {
return fs.dir
}
func (fs *diskFilesystem) Rebase(base string) error {
if len(base) == 0 {
return fmt.Errorf("invalid base path provided")
}
dir, err := filepath.Abs(base)
if err != nil {
return err
}
base = dir
finfo, err := os.Stat(base)
if err != nil {
return fmt.Errorf("the provided base path '%s' doesn't exist", fs.dir)
}
if !finfo.IsDir() {
return fmt.Errorf("the provided base path '%s' must be a directory", fs.dir)
}
fs.dir = base
return nil
} }
func (fs *diskFilesystem) Type() string { func (fs *diskFilesystem) Type() string {
return "diskfs" return "disk"
}
func (fs *diskFilesystem) Metadata(key string) string {
fs.lock.RLock()
defer fs.lock.RUnlock()
return fs.metadata[key]
}
func (fs *diskFilesystem) SetMetadata(key, data string) {
fs.lock.Lock()
defer fs.lock.Unlock()
fs.metadata[key] = data
} }
func (fs *diskFilesystem) Size() (int64, int64) { func (fs *diskFilesystem) Size() (int64, int64) {
@ -196,7 +241,11 @@ func (fs *diskFilesystem) Size() (int64, int64) {
if time.Since(fs.lastSizeCheck) >= 10*time.Second { if time.Since(fs.lastSizeCheck) >= 10*time.Second {
var size int64 = 0 var size int64 = 0
fs.walk(func(path string, info os.FileInfo) { fs.walk(fs.root, func(path string, info os.FileInfo) {
if info.IsDir() {
return
}
size += info.Size() size += info.Size()
}) })
@ -205,17 +254,21 @@ func (fs *diskFilesystem) Size() (int64, int64) {
fs.lastSizeCheck = time.Now() fs.lastSizeCheck = time.Now()
} }
return fs.currentSize, fs.maxSize return fs.currentSize, -1
} }
func (fs *diskFilesystem) Resize(size int64) { func (fs *diskFilesystem) Purge(size int64) int64 {
fs.maxSize = size return 0
} }
func (fs *diskFilesystem) Files() int64 { func (fs *diskFilesystem) Files() int64 {
var nfiles int64 = 0 var nfiles int64 = 0
fs.walk(func(path string, info os.FileInfo) { fs.walk(fs.root, func(path string, info os.FileInfo) {
if info.IsDir() {
return
}
nfiles++ nfiles++
}) })
@ -223,38 +276,58 @@ func (fs *diskFilesystem) Files() int64 {
} }
func (fs *diskFilesystem) Symlink(oldname, newname string) error { func (fs *diskFilesystem) Symlink(oldname, newname string) error {
oldname = filepath.Join(fs.dir, filepath.Clean("/"+oldname)) oldname = fs.cleanPath(oldname)
newname = fs.cleanPath(newname)
if !filepath.IsAbs(newname) { info, err := os.Lstat(oldname)
return nil if err != nil {
return err
} }
newname = filepath.Join(fs.dir, filepath.Clean("/"+newname)) if info.Mode()&os.ModeSymlink != 0 {
return fmt.Errorf("%s can't link to another link (%s)", newname, oldname)
}
err := os.Symlink(oldname, newname) if info.IsDir() {
return fmt.Errorf("can't symlink directories")
}
return err return os.Symlink(oldname, newname)
} }
func (fs *diskFilesystem) Open(path string) File { func (fs *diskFilesystem) Open(path string) File {
path = filepath.Join(fs.dir, filepath.Clean("/"+path)) path = fs.cleanPath(path)
df := &diskFile{
root: fs.root,
name: strings.TrimPrefix(path, fs.root),
}
info, err := os.Lstat(path)
if err != nil {
return nil
}
df.mode = info.Mode()
f, err := os.Open(path) f, err := os.Open(path)
if err != nil { if err != nil {
return nil return nil
} }
df := &diskFile{ df.file = f
dir: fs.dir,
name: path,
file: f,
}
return df return df
} }
func (fs *diskFilesystem) Store(path string, r io.Reader) (int64, bool, error) { func (fs *diskFilesystem) ReadFile(path string) ([]byte, error) {
path = filepath.Join(fs.dir, filepath.Clean("/"+path)) path = fs.cleanPath(path)
return os.ReadFile(path)
}
func (fs *diskFilesystem) WriteFileReader(path string, r io.Reader) (int64, bool, error) {
path = fs.cleanPath(path)
replace := true replace := true
@ -276,16 +349,155 @@ func (fs *diskFilesystem) Store(path string, r io.Reader) (int64, bool, error) {
replace = false replace = false
} }
defer f.Close()
size, err := f.ReadFrom(r) size, err := f.ReadFrom(r)
if err != nil { if err != nil {
return -1, false, fmt.Errorf("reading data failed: %w", err) return -1, false, fmt.Errorf("reading data failed: %w", err)
} }
fs.lastSizeCheck = time.Time{}
return size, !replace, nil return size, !replace, nil
} }
func (fs *diskFilesystem) Delete(path string) int64 { func (fs *diskFilesystem) WriteFile(path string, data []byte) (int64, bool, error) {
path = filepath.Join(fs.dir, filepath.Clean("/"+path)) return fs.WriteFileReader(path, bytes.NewBuffer(data))
}
func (fs *diskFilesystem) WriteFileSafe(path string, data []byte) (int64, bool, error) {
path = fs.cleanPath(path)
dir, filename := filepath.Split(path)
tmpfile, err := os.CreateTemp(dir, filename)
if err != nil {
return -1, false, err
}
defer os.Remove(tmpfile.Name())
size, err := tmpfile.Write(data)
if err != nil {
return -1, false, err
}
if err := tmpfile.Close(); err != nil {
return -1, false, err
}
replace := false
if _, err := fs.Stat(path); err == nil {
replace = true
}
if err := fs.rename(tmpfile.Name(), path); err != nil {
return -1, false, err
}
fs.lastSizeCheck = time.Time{}
return int64(size), !replace, nil
}
func (fs *diskFilesystem) Rename(src, dst string) error {
src = fs.cleanPath(src)
dst = fs.cleanPath(dst)
return fs.rename(src, dst)
}
func (fs *diskFilesystem) rename(src, dst string) error {
if src == dst {
return nil
}
// First try to rename the file
if err := os.Rename(src, dst); err == nil {
return nil
}
// If renaming the file fails, copy the data
if err := fs.copy(src, dst); err != nil {
os.Remove(dst)
return fmt.Errorf("failed to copy files: %w", err)
}
if err := os.Remove(src); err != nil {
os.Remove(dst)
return fmt.Errorf("failed to remove source file: %w", err)
}
return nil
}
func (fs *diskFilesystem) Copy(src, dst string) error {
src = fs.cleanPath(src)
dst = fs.cleanPath(dst)
return fs.copy(src, dst)
}
func (fs *diskFilesystem) copy(src, dst string) error {
source, err := os.Open(src)
if err != nil {
return fmt.Errorf("failed to open source file: %w", err)
}
destination, err := os.Create(dst)
if err != nil {
source.Close()
return fmt.Errorf("failed to create destination file: %w", err)
}
defer destination.Close()
if _, err := io.Copy(destination, source); err != nil {
source.Close()
os.Remove(dst)
return fmt.Errorf("failed to copy data from source to destination: %w", err)
}
source.Close()
fs.lastSizeCheck = time.Time{}
return nil
}
func (fs *diskFilesystem) MkdirAll(path string, perm os.FileMode) error {
path = fs.cleanPath(path)
return os.MkdirAll(path, perm)
}
func (fs *diskFilesystem) Stat(path string) (FileInfo, error) {
path = fs.cleanPath(path)
dif := &diskFileInfo{
root: fs.root,
name: strings.TrimPrefix(path, fs.root),
}
info, err := os.Lstat(path)
if err != nil {
return nil, err
}
dif.mode = info.Mode()
if info.Mode()&os.ModeSymlink != 0 {
info, err = os.Stat(path)
if err != nil {
return nil, err
}
}
dif.finfo = info
return dif, nil
}
func (fs *diskFilesystem) Remove(path string) int64 {
path = fs.cleanPath(path)
finfo, err := os.Stat(path) finfo, err := os.Stat(path)
if err != nil { if err != nil {
@ -298,28 +510,31 @@ func (fs *diskFilesystem) Delete(path string) int64 {
return -1 return -1
} }
fs.lastSizeCheck = time.Time{}
return size return size
} }
func (fs *diskFilesystem) DeleteAll() int64 { func (fs *diskFilesystem) RemoveAll() int64 {
return 0 return 0
} }
func (fs *diskFilesystem) List(pattern string) []FileInfo { func (fs *diskFilesystem) List(path, pattern string) []FileInfo {
path = fs.cleanPath(path)
files := []FileInfo{} files := []FileInfo{}
fs.walk(func(path string, info os.FileInfo) { fs.walk(path, func(path string, info os.FileInfo) {
if path == fs.dir { if path == fs.root {
return return
} }
name := strings.TrimPrefix(path, fs.dir) name := strings.TrimPrefix(path, fs.root)
if name[0] != os.PathSeparator { if name[0] != os.PathSeparator {
name = string(os.PathSeparator) + name name = string(os.PathSeparator) + name
} }
if info.IsDir() { if info.IsDir() {
name += "/" return
} }
if len(pattern) != 0 { if len(pattern) != 0 {
@ -329,7 +544,7 @@ func (fs *diskFilesystem) List(pattern string) []FileInfo {
} }
files = append(files, &diskFileInfo{ files = append(files, &diskFileInfo{
dir: fs.dir, root: fs.root,
name: name, name: name,
finfo: info, finfo: info,
}) })
@ -338,8 +553,8 @@ func (fs *diskFilesystem) List(pattern string) []FileInfo {
return files return files
} }
func (fs *diskFilesystem) walk(walkfn func(path string, info os.FileInfo)) { func (fs *diskFilesystem) walk(path string, walkfn func(path string, info os.FileInfo)) {
filepath.Walk(fs.dir, func(path string, info os.FileInfo, err error) error { filepath.Walk(path, func(path string, info os.FileInfo, err error) error {
if err != nil { if err != nil {
return nil return nil
} }
@ -359,3 +574,11 @@ func (fs *diskFilesystem) walk(walkfn func(path string, info os.FileInfo)) {
return nil return nil
}) })
} }
func (fs *diskFilesystem) cleanPath(path string) string {
if !filepath.IsAbs(path) {
path = filepath.Join(fs.cwd, path)
}
return filepath.Join(fs.root, filepath.Clean(path))
}

View file

@ -1,48 +0,0 @@
package fs
import (
"io"
"time"
)
type dummyFileInfo struct{}
func (d *dummyFileInfo) Name() string { return "" }
func (d *dummyFileInfo) Size() int64 { return 0 }
func (d *dummyFileInfo) ModTime() time.Time { return time.Date(2000, 1, 1, 0, 0, 0, 0, nil) }
func (d *dummyFileInfo) IsLink() (string, bool) { return "", false }
func (d *dummyFileInfo) IsDir() bool { return false }
type dummyFile struct{}
func (d *dummyFile) Read(p []byte) (int, error) { return 0, io.EOF }
func (d *dummyFile) Close() error { return nil }
func (d *dummyFile) Name() string { return "" }
func (d *dummyFile) Stat() (FileInfo, error) { return &dummyFileInfo{}, nil }
type dummyFilesystem struct {
name string
typ string
}
func (d *dummyFilesystem) Name() string { return d.name }
func (d *dummyFilesystem) Base() string { return "/" }
func (d *dummyFilesystem) Rebase(string) error { return nil }
func (d *dummyFilesystem) Type() string { return d.typ }
func (d *dummyFilesystem) Size() (int64, int64) { return 0, -1 }
func (d *dummyFilesystem) Resize(int64) {}
func (d *dummyFilesystem) Files() int64 { return 0 }
func (d *dummyFilesystem) Symlink(string, string) error { return nil }
func (d *dummyFilesystem) Open(string) File { return &dummyFile{} }
func (d *dummyFilesystem) Store(string, io.Reader) (int64, bool, error) { return 0, true, nil }
func (d *dummyFilesystem) Delete(string) int64 { return 0 }
func (d *dummyFilesystem) DeleteAll() int64 { return 0 }
func (d *dummyFilesystem) List(string) []FileInfo { return []FileInfo{} }
// NewDummyFilesystem return a dummy filesystem
func NewDummyFilesystem(name, typ string) Filesystem {
return &dummyFilesystem{
name: name,
typ: typ,
}
}

View file

@ -3,24 +3,29 @@ package fs
import ( import (
"io" "io"
"io/fs"
"os"
"time" "time"
) )
// FileInfo describes a file and is returned by Stat. // FileInfo describes a file and is returned by Stat.
type FileInfo interface { type FileInfo interface {
// Name returns the full name of the file // Name returns the full name of the file.
Name() string Name() string
// Size reports the size of the file in bytes // Size reports the size of the file in bytes.
Size() int64 Size() int64
// ModTime returns the time of last modification // Mode returns the file mode.
Mode() fs.FileMode
// ModTime returns the time of last modification.
ModTime() time.Time ModTime() time.Time
// IsLink returns the path this file is linking to and true. Otherwise an empty string and false. // IsLink returns the path this file is linking to and true. Otherwise an empty string and false.
IsLink() (string, bool) IsLink() (string, bool)
// IsDir returns whether the file represents a directory // IsDir returns whether the file represents a directory.
IsDir() bool IsDir() bool
} }
@ -28,58 +33,95 @@ type FileInfo interface {
type File interface { type File interface {
io.ReadCloser io.ReadCloser
// Name returns the Name of the file // Name returns the Name of the file.
Name() string Name() string
// Stat returns the FileInfo to this file. In case of an error // Stat returns the FileInfo to this file. In case of an error FileInfo is nil
// FileInfo is nil and the error is non-nil. // and the error is non-nil. If the file is a symlink, the info reports the name and mode
// of the link itself, but the modification time and size of the linked file.
Stat() (FileInfo, error) Stat() (FileInfo, error)
} }
// Filesystem is an interface that provides access to a filesystem. type ReadFilesystem interface {
type Filesystem interface {
// Name returns the name of this filesystem
Name() string
// Base returns the base path of this filesystem
Base() string
// Rebase sets a new base path for this filesystem
Rebase(string) error
// Type returns the type of this filesystem
Type() string
// Size returns the consumed size and capacity of the filesystem in bytes. The // Size returns the consumed size and capacity of the filesystem in bytes. The
// capacity is negative if the filesystem can consume as much space as it can. // capacity is negative if the filesystem can consume as much space as it wants.
Size() (int64, int64) Size() (int64, int64)
// Resize resizes the filesystem to the new size. Files may need to be deleted.
Resize(size int64)
// Files returns the current number of files in the filesystem. // Files returns the current number of files in the filesystem.
Files() int64 Files() int64
// Open returns the file stored at the given path. It returns nil if the
// file doesn't exist. If the file is a symlink, the name is the name of
// the link, but it will read the contents of the linked file.
Open(path string) File
// ReadFile reads the content of the file at the given path into the writer. Returns
// the number of bytes read or an error.
ReadFile(path string) ([]byte, error)
// Stat returns info about the file at path. If the file doesn't exist, an error
// will be returned. If the file is a symlink, the info reports the name and mode
// of the link itself, but the modification time and size are of the linked file.
Stat(path string) (FileInfo, error)
// List lists all files that are currently on the filesystem.
List(path, pattern string) []FileInfo
}
type WriteFilesystem interface {
// Symlink creates newname as a symbolic link to oldname. // Symlink creates newname as a symbolic link to oldname.
Symlink(oldname, newname string) error Symlink(oldname, newname string) error
// Open returns the file stored at the given path. It returns nil if the // WriteFileReader adds a file to the filesystem. Returns the size of the data that has been
// file doesn't exist.
Open(path string) File
// Store adds a file to the filesystem. Returns the size of the data that has been
// stored in bytes and whether the file is new. The size is negative if there was // stored in bytes and whether the file is new. The size is negative if there was
// an error adding the file and error is not nil. // an error adding the file and error is not nil.
Store(path string, r io.Reader) (int64, bool, error) WriteFileReader(path string, r io.Reader) (int64, bool, error)
// Delete removes a file at the given path from the filesystem. Returns the size of // WriteFile adds a file to the filesystem. Returns the size of the data that has been
// the removed file in bytes. The size is negative if the file doesn't exist. // stored in bytes and whether the file is new. The size is negative if there was
Delete(path string) int64 // an error adding the file and error is not nil.
WriteFile(path string, data []byte) (int64, bool, error)
// DeleteAll removes all files from the filesystem. Returns the size of the // WriteFileSafe adds a file to the filesystem by first writing it to a tempfile and then
// renaming it to the actual path. Returns the size of the data that has been
// stored in bytes and whether the file is new. The size is negative if there was
// an error adding the file and error is not nil.
WriteFileSafe(path string, data []byte) (int64, bool, error)
// MkdirAll creates a directory named path, along with any necessary parents, and returns nil,
// or else returns an error. The permission bits perm (before umask) are used for all directories
// that MkdirAll creates. If path is already a directory, MkdirAll does nothing and returns nil.
MkdirAll(path string, perm os.FileMode) error
// Rename renames the file from src to dst. If src and dst can't be renamed
// regularly, the data is copied from src to dst. dst will be overwritten
// if it already exists. src will be removed after all data has been copied
// successfully. Both files exist during copying.
Rename(src, dst string) error
// Copy copies a file from src to dst.
Copy(src, dst string) error
// Remove removes a file at the given path from the filesystem. Returns the size of
// the remove file in bytes. The size is negative if the file doesn't exist.
Remove(path string) int64
// RemoveAll removes all files from the filesystem. Returns the size of the
// removed files in bytes. // removed files in bytes.
DeleteAll() int64 RemoveAll() int64
}
// List lists all files that are currently on the filesystem.
List(pattern string) []FileInfo // Filesystem is an interface that provides access to a filesystem.
type Filesystem interface {
ReadFilesystem
WriteFilesystem
// Name returns the name of the filesystem.
Name() string
// Type returns the type of the filesystem, e.g. disk, mem, s3
Type() string
Metadata(key string) string
SetMetadata(key string, data string)
} }

742
io/fs/fs_test.go Normal file
View file

@ -0,0 +1,742 @@
package fs
import (
"errors"
"io"
"os"
"os/exec"
"path/filepath"
"strings"
"testing"
"time"
"github.com/stretchr/testify/require"
)
var ErrNoMinio = errors.New("minio binary not found")
func startMinio(t *testing.T, path string) (*exec.Cmd, error) {
err := os.MkdirAll(path, 0700)
require.NoError(t, err)
minio, err := exec.LookPath("minio")
if err != nil {
return nil, ErrNoMinio
}
proc := exec.Command(minio, "server", path, "--address", "127.0.0.1:9000")
proc.Stderr = os.Stderr
proc.Stdout = os.Stdout
err = proc.Start()
require.NoError(t, err)
time.Sleep(5 * time.Second)
return proc, nil
}
func stopMinio(t *testing.T, proc *exec.Cmd) {
err := proc.Process.Signal(os.Interrupt)
require.NoError(t, err)
proc.Wait()
}
func TestFilesystem(t *testing.T) {
miniopath, err := filepath.Abs("./minio")
require.NoError(t, err)
err = os.RemoveAll(miniopath)
require.NoError(t, err)
minio, err := startMinio(t, miniopath)
if err != nil {
if err != ErrNoMinio {
require.NoError(t, err)
}
}
os.RemoveAll("./testing/")
filesystems := map[string]func(string) (Filesystem, error){
"memfs": func(name string) (Filesystem, error) {
return NewMemFilesystem(MemConfig{})
},
"diskfs": func(name string) (Filesystem, error) {
return NewRootedDiskFilesystem(RootedDiskConfig{
Root: "./testing/" + name,
})
},
"s3fs": func(name string) (Filesystem, error) {
return NewS3Filesystem(S3Config{
Name: name,
Endpoint: "127.0.0.1:9000",
AccessKeyID: "minioadmin",
SecretAccessKey: "minioadmin",
Region: "",
Bucket: strings.ToLower(name),
UseSSL: false,
Logger: nil,
})
},
}
tests := map[string]func(*testing.T, Filesystem){
"new": testNew,
"metadata": testMetadata,
"writeFile": testWriteFile,
"writeFileSafe": testWriteFileSafe,
"writeFileReader": testWriteFileReader,
"delete": testDelete,
"files": testFiles,
"replace": testReplace,
"list": testList,
"listGlob": testListGlob,
"deleteAll": testDeleteAll,
"data": testData,
"statDir": testStatDir,
"mkdirAll": testMkdirAll,
"rename": testRename,
"renameOverwrite": testRenameOverwrite,
"copy": testCopy,
"symlink": testSymlink,
"stat": testStat,
"copyOverwrite": testCopyOverwrite,
"symlinkErrors": testSymlinkErrors,
"symlinkOpenStat": testSymlinkOpenStat,
"open": testOpen,
}
for fsname, fs := range filesystems {
for name, test := range tests {
t.Run(fsname+"-"+name, func(t *testing.T) {
if fsname == "s3fs" && minio == nil {
t.Skip("minio server not available")
}
filesystem, err := fs(name)
require.NoError(t, err)
test(t, filesystem)
})
}
}
os.RemoveAll("./testing/")
if minio != nil {
stopMinio(t, minio)
}
os.RemoveAll(miniopath)
}
func testNew(t *testing.T, fs Filesystem) {
cur, max := fs.Size()
require.Equal(t, int64(0), cur, "current size")
require.Equal(t, int64(-1), max, "max size")
cur = fs.Files()
require.Equal(t, int64(0), cur, "number of files")
}
func testMetadata(t *testing.T, fs Filesystem) {
fs.SetMetadata("foo", "bar")
require.Equal(t, "bar", fs.Metadata("foo"))
}
func testWriteFile(t *testing.T, fs Filesystem) {
size, created, err := fs.WriteFile("/foobar", []byte("xxxxx"))
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func testWriteFileSafe(t *testing.T, fs Filesystem) {
size, created, err := fs.WriteFileSafe("/foobar", []byte("xxxxx"))
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func testWriteFileReader(t *testing.T, fs Filesystem) {
data := strings.NewReader("xxxxx")
size, created, err := fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func testOpen(t *testing.T, fs Filesystem) {
file := fs.Open("/foobar")
require.Nil(t, file)
_, _, err := fs.WriteFileReader("/foobar", strings.NewReader("xxxxx"))
require.NoError(t, err)
file = fs.Open("/foobar")
require.NotNil(t, file)
require.Equal(t, "/foobar", file.Name())
stat, err := file.Stat()
require.NoError(t, err)
require.Equal(t, "/foobar", stat.Name())
require.Equal(t, int64(5), stat.Size())
require.Equal(t, false, stat.IsDir())
}
func testDelete(t *testing.T, fs Filesystem) {
size := fs.Remove("/foobar")
require.Equal(t, int64(-1), size)
data := strings.NewReader("xxxxx")
fs.WriteFileReader("/foobar", data)
size = fs.Remove("/foobar")
require.Equal(t, int64(5), size)
cur, max := fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(0), cur)
}
func testFiles(t *testing.T, fs Filesystem) {
require.Equal(t, int64(0), fs.Files())
fs.WriteFileReader("/foobar.txt", strings.NewReader("bar"))
require.Equal(t, int64(1), fs.Files())
fs.MkdirAll("/path/to/foo", 0777)
require.Equal(t, int64(1), fs.Files())
fs.Remove("/foobar.txt")
require.Equal(t, int64(0), fs.Files())
}
func testReplace(t *testing.T, fs Filesystem) {
data := strings.NewReader("xxxxx")
size, created, err := fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
data = strings.NewReader("yyy")
size, created, err = fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(3), size)
require.Equal(t, false, created)
cur, max = fs.Size()
require.Equal(t, int64(3), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func testList(t *testing.T, fs Filesystem) {
fs.WriteFileReader("/foobar1", strings.NewReader("a"))
fs.WriteFileReader("/foobar2", strings.NewReader("bb"))
fs.WriteFileReader("/foobar3", strings.NewReader("ccc"))
fs.WriteFileReader("/foobar4", strings.NewReader("dddd"))
fs.WriteFileReader("/path/foobar3", strings.NewReader("ccc"))
fs.WriteFileReader("/path/to/foobar4", strings.NewReader("dddd"))
cur, max := fs.Size()
require.Equal(t, int64(17), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(6), cur)
getNames := func(files []FileInfo) []string {
names := []string{}
for _, f := range files {
names = append(names, f.Name())
}
return names
}
files := fs.List("/", "")
require.Equal(t, 6, len(files))
require.ElementsMatch(t, []string{"/foobar1", "/foobar2", "/foobar3", "/foobar4", "/path/foobar3", "/path/to/foobar4"}, getNames(files))
files = fs.List("/path", "")
require.Equal(t, 2, len(files))
require.ElementsMatch(t, []string{"/path/foobar3", "/path/to/foobar4"}, getNames(files))
}
func testListGlob(t *testing.T, fs Filesystem) {
fs.WriteFileReader("/foobar1", strings.NewReader("a"))
fs.WriteFileReader("/path/foobar2", strings.NewReader("a"))
fs.WriteFileReader("/path/to/foobar3", strings.NewReader("a"))
fs.WriteFileReader("/foobar4", strings.NewReader("a"))
cur := fs.Files()
require.Equal(t, int64(4), cur)
getNames := func(files []FileInfo) []string {
names := []string{}
for _, f := range files {
names = append(names, f.Name())
}
return names
}
files := getNames(fs.List("/", "/foo*"))
require.Equal(t, 2, len(files))
require.ElementsMatch(t, []string{"/foobar1", "/foobar4"}, files)
files = getNames(fs.List("/", "/*bar?"))
require.Equal(t, 2, len(files))
require.ElementsMatch(t, []string{"/foobar1", "/foobar4"}, files)
files = getNames(fs.List("/", "/path/*"))
require.Equal(t, 1, len(files))
require.ElementsMatch(t, []string{"/path/foobar2"}, files)
files = getNames(fs.List("/", "/path/**"))
require.Equal(t, 2, len(files))
require.ElementsMatch(t, []string{"/path/foobar2", "/path/to/foobar3"}, files)
files = getNames(fs.List("/path", "/**"))
require.Equal(t, 2, len(files))
require.ElementsMatch(t, []string{"/path/foobar2", "/path/to/foobar3"}, files)
}
func testDeleteAll(t *testing.T, fs Filesystem) {
if _, ok := fs.(*diskFilesystem); ok {
return
}
fs.WriteFileReader("/foobar1", strings.NewReader("abc"))
fs.WriteFileReader("/path/foobar2", strings.NewReader("abc"))
fs.WriteFileReader("/path/to/foobar3", strings.NewReader("abc"))
fs.WriteFileReader("/foobar4", strings.NewReader("abc"))
cur := fs.Files()
require.Equal(t, int64(4), cur)
size := fs.RemoveAll()
require.Equal(t, int64(12), size)
cur = fs.Files()
require.Equal(t, int64(0), cur)
}
func testData(t *testing.T, fs Filesystem) {
file := fs.Open("/foobar")
require.Nil(t, file)
_, err := fs.ReadFile("/foobar")
require.Error(t, err)
data := "gduwotoxqb"
data1 := strings.NewReader(data)
_, _, err = fs.WriteFileReader("/foobar", data1)
require.NoError(t, err)
file = fs.Open("/foobar")
require.NotNil(t, file)
data2 := make([]byte, len(data)+1)
n, err := file.Read(data2)
if err != nil {
if err != io.EOF {
require.NoError(t, err)
}
}
require.Equal(t, len(data), n)
require.Equal(t, []byte(data), data2[:n])
data3, err := fs.ReadFile("/foobar")
require.NoError(t, err)
require.Equal(t, []byte(data), data3)
}
func testStatDir(t *testing.T, fs Filesystem) {
info, err := fs.Stat("/")
require.NoError(t, err)
require.NotNil(t, info)
require.Equal(t, true, info.IsDir())
data := strings.NewReader("gduwotoxqb")
fs.WriteFileReader("/these/are/some/directories/foobar", data)
info, err = fs.Stat("/foobar")
require.Error(t, err)
require.Nil(t, info)
info, err = fs.Stat("/these/are/some/directories/foobar")
require.NoError(t, err)
require.Equal(t, "/these/are/some/directories/foobar", info.Name())
require.Equal(t, int64(10), info.Size())
require.Equal(t, false, info.IsDir())
info, err = fs.Stat("/these")
require.NoError(t, err)
require.Equal(t, "/these", info.Name())
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/these/are/")
require.NoError(t, err)
require.Equal(t, "/these/are", info.Name())
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/these/are/some")
require.NoError(t, err)
require.Equal(t, "/these/are/some", info.Name())
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/these/are/some/directories")
require.NoError(t, err)
require.Equal(t, "/these/are/some/directories", info.Name())
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
}
func testMkdirAll(t *testing.T, fs Filesystem) {
info, err := fs.Stat("/foo/bar/dir")
require.Error(t, err)
require.Nil(t, info)
err = fs.MkdirAll("/foo/bar/dir", 0755)
require.NoError(t, err)
err = fs.MkdirAll("/foo/bar", 0755)
require.NoError(t, err)
info, err = fs.Stat("/foo/bar/dir")
require.NoError(t, err)
require.NotNil(t, info)
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/")
require.NoError(t, err)
require.NotNil(t, info)
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/foo")
require.NoError(t, err)
require.NotNil(t, info)
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
info, err = fs.Stat("/foo/bar")
require.NoError(t, err)
require.NotNil(t, info)
require.Equal(t, int64(0), info.Size())
require.Equal(t, true, info.IsDir())
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("gduwotoxqb"))
require.NoError(t, err)
err = fs.MkdirAll("/foobar", 0755)
require.Error(t, err)
}
func testRename(t *testing.T, fs Filesystem) {
err := fs.Rename("/foobar", "/foobaz")
require.Error(t, err)
_, err = fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("gduwotoxqb"))
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
err = fs.Rename("/foobar", "/foobaz")
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
}
func testRenameOverwrite(t *testing.T, fs Filesystem) {
_, err := fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
_, _, err = fs.WriteFileReader("/foobaz", strings.NewReader("foobaz"))
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
err = fs.Rename("/foobar", "/foobaz")
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
data, err := fs.ReadFile("/foobaz")
require.NoError(t, err)
require.Equal(t, "foobar", string(data))
}
func testSymlink(t *testing.T, fs Filesystem) {
if _, ok := fs.(*s3Filesystem); ok {
return
}
err := fs.Symlink("/foobar", "/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
err = fs.Symlink("/foobar", "/foobaz")
require.NoError(t, err)
file := fs.Open("/foobaz")
require.NotNil(t, file)
require.Equal(t, "/foobaz", file.Name())
data := make([]byte, 10)
n, err := file.Read(data)
if err != nil {
if err != io.EOF {
require.NoError(t, err)
}
}
require.NoError(t, err)
require.Equal(t, 6, n)
require.Equal(t, "foobar", string(data[:n]))
stat, err := fs.Stat("/foobaz")
require.NoError(t, err)
require.Equal(t, "/foobaz", stat.Name())
require.Equal(t, int64(6), stat.Size())
require.NotEqual(t, 0, int(stat.Mode()&os.ModeSymlink))
link, ok := stat.IsLink()
require.Equal(t, "/foobar", link)
require.Equal(t, true, ok)
data, err = fs.ReadFile("/foobaz")
require.NoError(t, err)
require.Equal(t, "foobar", string(data))
}
func testSymlinkOpenStat(t *testing.T, fs Filesystem) {
if _, ok := fs.(*s3Filesystem); ok {
return
}
_, _, err := fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
err = fs.Symlink("/foobar", "/foobaz")
require.NoError(t, err)
file := fs.Open("/foobaz")
require.NotNil(t, file)
require.Equal(t, "/foobaz", file.Name())
fstat, err := file.Stat()
require.NoError(t, err)
stat, err := fs.Stat("/foobaz")
require.NoError(t, err)
require.Equal(t, "/foobaz", fstat.Name())
require.Equal(t, fstat.Name(), stat.Name())
require.Equal(t, int64(6), fstat.Size())
require.Equal(t, fstat.Size(), stat.Size())
require.NotEqual(t, 0, int(fstat.Mode()&os.ModeSymlink))
require.Equal(t, fstat.Mode(), stat.Mode())
}
func testStat(t *testing.T, fs Filesystem) {
_, _, err := fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
file := fs.Open("/foobar")
require.NotNil(t, file)
stat1, err := fs.Stat("/foobar")
require.NoError(t, err)
stat2, err := file.Stat()
require.NoError(t, err)
require.Equal(t, stat1, stat2)
}
func testCopy(t *testing.T, fs Filesystem) {
err := fs.Rename("/foobar", "/foobaz")
require.Error(t, err)
_, err = fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("gduwotoxqb"))
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
err = fs.Copy("/foobar", "/foobaz")
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
}
func testCopyOverwrite(t *testing.T, fs Filesystem) {
_, err := fs.Stat("/foobar")
require.Error(t, err)
_, err = fs.Stat("/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
_, _, err = fs.WriteFileReader("/foobaz", strings.NewReader("foobaz"))
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
err = fs.Copy("/foobar", "/foobaz")
require.NoError(t, err)
_, err = fs.Stat("/foobar")
require.NoError(t, err)
_, err = fs.Stat("/foobaz")
require.NoError(t, err)
data, err := fs.ReadFile("/foobaz")
require.NoError(t, err)
require.Equal(t, "foobar", string(data))
}
func testSymlinkErrors(t *testing.T, fs Filesystem) {
if _, ok := fs.(*s3Filesystem); ok {
return
}
err := fs.Symlink("/foobar", "/foobaz")
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobar", strings.NewReader("foobar"))
require.NoError(t, err)
_, _, err = fs.WriteFileReader("/foobaz", strings.NewReader("foobaz"))
require.NoError(t, err)
err = fs.Symlink("/foobar", "/foobaz")
require.Error(t, err)
err = fs.Symlink("/foobar", "/bazfoo")
require.NoError(t, err)
err = fs.Symlink("/bazfoo", "/barfoo")
require.Error(t, err)
}

View file

@ -4,7 +4,11 @@ import (
"bytes" "bytes"
"fmt" "fmt"
"io" "io"
"io/fs"
"os"
"path/filepath"
"sort" "sort"
"strings"
"sync" "sync"
"time" "time"
@ -15,28 +19,15 @@ import (
// MemConfig is the config that is required for creating // MemConfig is the config that is required for creating
// a new memory filesystem. // a new memory filesystem.
type MemConfig struct { type MemConfig struct {
// Namee is the name of the filesystem Logger log.Logger // For logging, optional
Name string
// Base is the base path to be reported for this filesystem
Base string
// Size is the capacity of the filesystem in bytes
Size int64
// Set true to automatically delete the oldest files until there's
// enough space to store a new file
Purge bool
// For logging, optional
Logger log.Logger
} }
type memFileInfo struct { type memFileInfo struct {
name string name string // Full name of the file (including path)
size int64 size int64 // The size of the file in bytes
lastMod time.Time dir bool // Whether this file represents a directory
linkTo string lastMod time.Time // The time of the last modification of the file
linkTo string // Where the file links to, empty if it's not a link
} }
func (f *memFileInfo) Name() string { func (f *memFileInfo) Name() string {
@ -47,6 +38,20 @@ func (f *memFileInfo) Size() int64 {
return f.size return f.size
} }
func (f *memFileInfo) Mode() fs.FileMode {
mode := fs.FileMode(fs.ModePerm)
if f.dir {
mode |= fs.ModeDir
}
if len(f.linkTo) != 0 {
mode |= fs.ModeSymlink
}
return mode
}
func (f *memFileInfo) ModTime() time.Time { func (f *memFileInfo) ModTime() time.Time {
return f.lastMod return f.lastMod
} }
@ -56,24 +61,12 @@ func (f *memFileInfo) IsLink() (string, bool) {
} }
func (f *memFileInfo) IsDir() bool { func (f *memFileInfo) IsDir() bool {
return false return f.dir
} }
type memFile struct { type memFile struct {
// Name of the file memFileInfo
name string data *bytes.Buffer // Contents of the file
// Size of the file in bytes
size int64
// Last modification of the file as a UNIX timestamp
lastMod time.Time
// Contents of the file
data *bytes.Buffer
// Link to another file
linkTo string
} }
func (f *memFile) Name() string { func (f *memFile) Name() string {
@ -84,6 +77,7 @@ func (f *memFile) Stat() (FileInfo, error) {
info := &memFileInfo{ info := &memFileInfo{
name: f.name, name: f.name,
size: f.size, size: f.size,
dir: f.dir,
lastMod: f.lastMod, lastMod: f.lastMod,
linkTo: f.linkTo, linkTo: f.linkTo,
} }
@ -110,8 +104,8 @@ func (f *memFile) Close() error {
} }
type memFilesystem struct { type memFilesystem struct {
name string metadata map[string]string
base string metaLock sync.RWMutex
// Mapping of path to file // Mapping of path to file
files map[string]*memFile files map[string]*memFile
@ -122,28 +116,18 @@ type memFilesystem struct {
// Pool for the storage of the contents of files // Pool for the storage of the contents of files
dataPool sync.Pool dataPool sync.Pool
// Max. size of the filesystem in bytes as
// given by the config
maxSize int64
// Current size of the filesystem in bytes // Current size of the filesystem in bytes
currentSize int64 currentSize int64
// Purge setting from the config
purge bool
// Logger from the config // Logger from the config
logger log.Logger logger log.Logger
} }
// NewMemFilesystem creates a new filesystem in memory that implements // NewMemFilesystem creates a new filesystem in memory that implements
// the Filesystem interface. // the Filesystem interface.
func NewMemFilesystem(config MemConfig) Filesystem { func NewMemFilesystem(config MemConfig) (Filesystem, error) {
fs := &memFilesystem{ fs := &memFilesystem{
name: config.Name, metadata: make(map[string]string),
base: config.Base,
maxSize: config.Size,
purge: config.Purge,
logger: config.Logger, logger: config.Logger,
} }
@ -161,70 +145,105 @@ func NewMemFilesystem(config MemConfig) Filesystem {
}, },
} }
fs.logger.WithFields(log.Fields{ fs.logger.Debug().Log("Created")
"name": fs.name,
"size_bytes": fs.maxSize,
"purge": fs.purge,
}).Debug().Log("Created")
return fs return fs, nil
}
func NewMemFilesystemFromDir(dir string, config MemConfig) (Filesystem, error) {
mem, err := NewMemFilesystem(config)
if err != nil {
return nil, err
}
err = filepath.Walk(dir, func(path string, info os.FileInfo, err error) error {
if err != nil {
return nil
}
if info.IsDir() {
return nil
}
mode := info.Mode()
if !mode.IsRegular() {
return nil
}
if mode&os.ModeSymlink != 0 {
return nil
}
file, err := os.Open(path)
if err != nil {
return nil
}
defer file.Close()
_, _, err = mem.WriteFileReader(path, file)
if err != nil {
return fmt.Errorf("can't copy %s", path)
}
return nil
})
if err != nil {
return nil, err
}
return mem, nil
} }
func (fs *memFilesystem) Name() string { func (fs *memFilesystem) Name() string {
return fs.name return "mem"
}
func (fs *memFilesystem) Base() string {
return fs.base
}
func (fs *memFilesystem) Rebase(base string) error {
fs.base = base
return nil
} }
func (fs *memFilesystem) Type() string { func (fs *memFilesystem) Type() string {
return "memfs" return "mem"
}
func (fs *memFilesystem) Metadata(key string) string {
fs.metaLock.RLock()
defer fs.metaLock.RUnlock()
return fs.metadata[key]
}
func (fs *memFilesystem) SetMetadata(key, data string) {
fs.metaLock.Lock()
defer fs.metaLock.Unlock()
fs.metadata[key] = data
} }
func (fs *memFilesystem) Size() (int64, int64) { func (fs *memFilesystem) Size() (int64, int64) {
fs.filesLock.RLock() fs.filesLock.RLock()
defer fs.filesLock.RUnlock() defer fs.filesLock.RUnlock()
return fs.currentSize, fs.maxSize return fs.currentSize, -1
}
func (fs *memFilesystem) Resize(size int64) {
fs.filesLock.Lock()
defer fs.filesLock.Unlock()
diffSize := fs.maxSize - size
if diffSize == 0 {
return
}
if diffSize > 0 {
fs.free(diffSize)
}
fs.logger.WithFields(log.Fields{
"from_bytes": fs.maxSize,
"to_bytes": size,
}).Debug().Log("Resizing")
fs.maxSize = size
} }
func (fs *memFilesystem) Files() int64 { func (fs *memFilesystem) Files() int64 {
fs.filesLock.RLock() fs.filesLock.RLock()
defer fs.filesLock.RUnlock() defer fs.filesLock.RUnlock()
return int64(len(fs.files)) nfiles := int64(0)
for _, f := range fs.files {
if f.dir {
continue
}
nfiles++
}
return nfiles
} }
func (fs *memFilesystem) Open(path string) File { func (fs *memFilesystem) Open(path string) File {
path = fs.cleanPath(path)
fs.filesLock.RLock() fs.filesLock.RLock()
file, ok := fs.files[path] file, ok := fs.files[path]
fs.filesLock.RUnlock() fs.filesLock.RUnlock()
@ -234,29 +253,68 @@ func (fs *memFilesystem) Open(path string) File {
} }
newFile := &memFile{ newFile := &memFile{
memFileInfo: memFileInfo{
name: file.name, name: file.name,
size: file.size, size: file.size,
lastMod: file.lastMod, lastMod: file.lastMod,
linkTo: file.linkTo, linkTo: file.linkTo,
},
}
if len(file.linkTo) != 0 {
file, ok = fs.files[file.linkTo]
if !ok {
return nil
}
} }
if file.data != nil { if file.data != nil {
newFile.lastMod = file.lastMod
newFile.data = bytes.NewBuffer(file.data.Bytes()) newFile.data = bytes.NewBuffer(file.data.Bytes())
newFile.size = int64(newFile.data.Len())
} }
return newFile return newFile
} }
func (fs *memFilesystem) ReadFile(path string) ([]byte, error) {
path = fs.cleanPath(path)
fs.filesLock.RLock()
file, ok := fs.files[path]
fs.filesLock.RUnlock()
if !ok {
return nil, os.ErrNotExist
}
if len(file.linkTo) != 0 {
file, ok = fs.files[file.linkTo]
if !ok {
return nil, os.ErrNotExist
}
}
if file.data != nil {
return file.data.Bytes(), nil
}
return nil, nil
}
func (fs *memFilesystem) Symlink(oldname, newname string) error { func (fs *memFilesystem) Symlink(oldname, newname string) error {
oldname = fs.cleanPath(oldname)
newname = fs.cleanPath(newname)
fs.filesLock.Lock() fs.filesLock.Lock()
defer fs.filesLock.Unlock() defer fs.filesLock.Unlock()
if _, ok := fs.files[newname]; ok { if _, ok := fs.files[oldname]; !ok {
return fmt.Errorf("%s already exist", newname) return os.ErrNotExist
} }
if oldname[0] != '/' { if _, ok := fs.files[newname]; ok {
oldname = "/" + oldname return os.ErrExist
} }
if file, ok := fs.files[oldname]; ok { if file, ok := fs.files[oldname]; ok {
@ -266,11 +324,14 @@ func (fs *memFilesystem) Symlink(oldname, newname string) error {
} }
newFile := &memFile{ newFile := &memFile{
memFileInfo: memFileInfo{
name: newname, name: newname,
dir: false,
size: 0, size: 0,
lastMod: time.Now(), lastMod: time.Now(),
data: nil,
linkTo: oldname, linkTo: oldname,
},
data: nil,
} }
fs.files[newname] = newFile fs.files[newname] = newFile
@ -278,18 +339,21 @@ func (fs *memFilesystem) Symlink(oldname, newname string) error {
return nil return nil
} }
func (fs *memFilesystem) Store(path string, r io.Reader) (int64, bool, error) { func (fs *memFilesystem) WriteFileReader(path string, r io.Reader) (int64, bool, error) {
path = fs.cleanPath(path)
newFile := &memFile{ newFile := &memFile{
memFileInfo: memFileInfo{
name: path, name: path,
dir: false,
size: 0, size: 0,
lastMod: time.Now(), lastMod: time.Now(),
data: nil, },
data: fs.dataPool.Get().(*bytes.Buffer),
} }
data := fs.dataPool.Get().(*bytes.Buffer) newFile.data.Reset()
data.Reset() size, err := newFile.data.ReadFrom(r)
size, err := data.ReadFrom(r)
if err != nil { if err != nil {
fs.logger.WithFields(log.Fields{ fs.logger.WithFields(log.Fields{
"path": path, "path": path,
@ -297,55 +361,26 @@ func (fs *memFilesystem) Store(path string, r io.Reader) (int64, bool, error) {
"error": err, "error": err,
}).Warn().Log("Incomplete file") }).Warn().Log("Incomplete file")
} }
newFile.size = size
newFile.data = data
// reject if the new file is larger than the available space newFile.size = size
if fs.maxSize > 0 && newFile.size > fs.maxSize {
fs.dataPool.Put(data)
return -1, false, fmt.Errorf("File is too big")
}
fs.filesLock.Lock() fs.filesLock.Lock()
defer fs.filesLock.Unlock() defer fs.filesLock.Unlock()
// calculate the new size of the filesystem
newSize := fs.currentSize + newFile.size
file, replace := fs.files[path] file, replace := fs.files[path]
if replace {
newSize -= file.size
}
if fs.maxSize > 0 {
if newSize > fs.maxSize {
if !fs.purge {
fs.dataPool.Put(data)
return -1, false, fmt.Errorf("not enough space on device")
}
if replace { if replace {
delete(fs.files, path) delete(fs.files, path)
fs.currentSize -= file.size fs.currentSize -= file.size
fs.dataPool.Put(file.data) fs.dataPool.Put(file.data)
file.data = nil file.data = nil
} }
newSize -= fs.free(fs.currentSize + newFile.size - fs.maxSize)
}
} else {
if replace {
delete(fs.files, path)
fs.dataPool.Put(file.data)
file.data = nil
}
}
fs.currentSize = newSize
fs.files[path] = newFile fs.files[path] = newFile
fs.currentSize += newFile.size
logger := fs.logger.WithFields(log.Fields{ logger := fs.logger.WithFields(log.Fields{
"path": newFile.name, "path": newFile.name,
"filesize_bytes": newFile.size, "filesize_bytes": newFile.size,
@ -361,7 +396,18 @@ func (fs *memFilesystem) Store(path string, r io.Reader) (int64, bool, error) {
return newFile.size, !replace, nil return newFile.size, !replace, nil
} }
func (fs *memFilesystem) free(size int64) int64 { func (fs *memFilesystem) WriteFile(path string, data []byte) (int64, bool, error) {
return fs.WriteFileReader(path, bytes.NewBuffer(data))
}
func (fs *memFilesystem) WriteFileSafe(path string, data []byte) (int64, bool, error) {
return fs.WriteFileReader(path, bytes.NewBuffer(data))
}
func (fs *memFilesystem) Purge(size int64) int64 {
fs.filesLock.Lock()
defer fs.filesLock.Unlock()
files := []*memFile{} files := []*memFile{}
for _, f := range fs.files { for _, f := range fs.files {
@ -399,7 +445,190 @@ func (fs *memFilesystem) free(size int64) int64 {
return freed return freed
} }
func (fs *memFilesystem) Delete(path string) int64 { func (fs *memFilesystem) MkdirAll(path string, perm os.FileMode) error {
path = fs.cleanPath(path)
fs.filesLock.Lock()
defer fs.filesLock.Unlock()
info, err := fs.stat(path)
if err == nil {
if info.IsDir() {
return nil
}
return os.ErrExist
}
f := &memFile{
memFileInfo: memFileInfo{
name: path,
size: 0,
dir: true,
lastMod: time.Now(),
},
data: nil,
}
fs.files[path] = f
return nil
}
func (fs *memFilesystem) Rename(src, dst string) error {
src = filepath.Join("/", filepath.Clean(src))
dst = filepath.Join("/", filepath.Clean(dst))
if src == dst {
return nil
}
fs.filesLock.Lock()
defer fs.filesLock.Unlock()
srcFile, ok := fs.files[src]
if !ok {
return os.ErrNotExist
}
dstFile, ok := fs.files[dst]
if ok {
fs.currentSize -= dstFile.size
fs.dataPool.Put(dstFile.data)
dstFile.data = nil
}
fs.files[dst] = srcFile
delete(fs.files, src)
return nil
}
func (fs *memFilesystem) Copy(src, dst string) error {
src = filepath.Join("/", filepath.Clean(src))
dst = filepath.Join("/", filepath.Clean(dst))
if src == dst {
return nil
}
fs.filesLock.Lock()
defer fs.filesLock.Unlock()
srcFile, ok := fs.files[src]
if !ok {
return os.ErrNotExist
}
if srcFile.dir {
return os.ErrNotExist
}
if fs.isDir(dst) {
return os.ErrInvalid
}
dstFile, ok := fs.files[dst]
if ok {
fs.currentSize -= dstFile.size
} else {
dstFile = &memFile{
memFileInfo: memFileInfo{
name: dst,
dir: false,
size: srcFile.size,
lastMod: time.Now(),
},
data: fs.dataPool.Get().(*bytes.Buffer),
}
}
dstFile.data.Reset()
dstFile.data.Write(srcFile.data.Bytes())
fs.currentSize += dstFile.size
fs.files[dst] = dstFile
return nil
}
func (fs *memFilesystem) Stat(path string) (FileInfo, error) {
path = fs.cleanPath(path)
fs.filesLock.RLock()
defer fs.filesLock.RUnlock()
return fs.stat(path)
}
func (fs *memFilesystem) stat(path string) (FileInfo, error) {
file, ok := fs.files[path]
if ok {
f := &memFileInfo{
name: file.name,
size: file.size,
dir: file.dir,
lastMod: file.lastMod,
linkTo: file.linkTo,
}
if len(f.linkTo) != 0 {
file, ok := fs.files[f.linkTo]
if !ok {
return nil, os.ErrNotExist
}
f.lastMod = file.lastMod
f.size = file.size
}
return f, nil
}
// Check for directories
if !fs.isDir(path) {
return nil, os.ErrNotExist
}
f := &memFileInfo{
name: path,
size: 0,
dir: true,
lastMod: time.Now(),
linkTo: "",
}
return f, nil
}
func (fs *memFilesystem) isDir(path string) bool {
file, ok := fs.files[path]
if ok {
return file.dir
}
if !strings.HasSuffix(path, "/") {
path = path + "/"
}
if path == "/" {
return true
}
for k := range fs.files {
if strings.HasPrefix(k, path) {
return true
}
}
return false
}
func (fs *memFilesystem) Remove(path string) int64 {
path = fs.cleanPath(path)
fs.filesLock.Lock() fs.filesLock.Lock()
defer fs.filesLock.Unlock() defer fs.filesLock.Unlock()
@ -423,7 +652,7 @@ func (fs *memFilesystem) Delete(path string) int64 {
return file.size return file.size
} }
func (fs *memFilesystem) DeleteAll() int64 { func (fs *memFilesystem) RemoveAll() int64 {
fs.filesLock.Lock() fs.filesLock.Lock()
defer fs.filesLock.Unlock() defer fs.filesLock.Unlock()
@ -435,19 +664,28 @@ func (fs *memFilesystem) DeleteAll() int64 {
return size return size
} }
func (fs *memFilesystem) List(pattern string) []FileInfo { func (fs *memFilesystem) List(path, pattern string) []FileInfo {
path = fs.cleanPath(path)
files := []FileInfo{} files := []FileInfo{}
fs.filesLock.RLock() fs.filesLock.RLock()
defer fs.filesLock.RUnlock() defer fs.filesLock.RUnlock()
for _, file := range fs.files { for _, file := range fs.files {
if !strings.HasPrefix(file.name, path) {
continue
}
if len(pattern) != 0 { if len(pattern) != 0 {
if ok, _ := glob.Match(pattern, file.name, '/'); !ok { if ok, _ := glob.Match(pattern, file.name, '/'); !ok {
continue continue
} }
} }
if file.dir {
continue
}
files = append(files, &memFileInfo{ files = append(files, &memFileInfo{
name: file.name, name: file.name,
size: file.size, size: file.size,
@ -458,3 +696,11 @@ func (fs *memFilesystem) List(pattern string) []FileInfo {
return files return files
} }
func (fs *memFilesystem) cleanPath(path string) string {
if !filepath.IsAbs(path) {
path = filepath.Join("/", path)
}
return filepath.Join("/", filepath.Clean(path))
}

View file

@ -1,406 +1,30 @@
package fs package fs
import ( import (
"strings"
"testing" "testing"
"time"
"github.com/stretchr/testify/assert" "github.com/stretchr/testify/require"
) )
func TestNew(t *testing.T) { func TestMemFromDir(t *testing.T) {
mem := NewMemFilesystem(MemConfig{ mem, err := NewMemFilesystemFromDir(".", MemConfig{})
Size: 10, require.NoError(t, err)
Purge: false,
})
cur, max := mem.Size() names := []string{}
for _, f := range mem.List("/", "/*.go") {
names = append(names, f.Name())
}
assert.Equal(t, int64(0), cur) require.ElementsMatch(t, []string{
assert.Equal(t, int64(10), max) "/disk.go",
"/fs_test.go",
cur = mem.Files() "/fs.go",
"/mem_test.go",
assert.Equal(t, int64(0), cur) "/mem.go",
} "/readonly_test.go",
"/readonly.go",
func TestSimplePutNoPurge(t *testing.T) { "/s3.go",
mem := NewMemFilesystem(MemConfig{ "/sized_test.go",
Size: 10, "/sized.go",
Purge: false, }, names)
})
data := strings.NewReader("xxxxx")
size, created, err := mem.Store("/foobar", data)
assert.Nil(t, err)
assert.Equal(t, int64(5), size)
assert.Equal(t, true, created)
cur, max := mem.Size()
assert.Equal(t, int64(5), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(1), cur)
}
func TestSimpleDelete(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
size := mem.Delete("/foobar")
assert.Equal(t, int64(-1), size)
data := strings.NewReader("xxxxx")
mem.Store("/foobar", data)
size = mem.Delete("/foobar")
assert.Equal(t, int64(5), size)
cur, max := mem.Size()
assert.Equal(t, int64(0), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(0), cur)
}
func TestReplaceNoPurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
data := strings.NewReader("xxxxx")
size, created, err := mem.Store("/foobar", data)
assert.Nil(t, err)
assert.Equal(t, int64(5), size)
assert.Equal(t, true, created)
cur, max := mem.Size()
assert.Equal(t, int64(5), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(1), cur)
data = strings.NewReader("yyy")
size, created, err = mem.Store("/foobar", data)
assert.Nil(t, err)
assert.Equal(t, int64(3), size)
assert.Equal(t, false, created)
cur, max = mem.Size()
assert.Equal(t, int64(3), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(1), cur)
}
func TestReplacePurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: true,
})
data1 := strings.NewReader("xxx")
data2 := strings.NewReader("yyy")
data3 := strings.NewReader("zzz")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
mem.Store("/foobar3", data3)
cur, max := mem.Size()
assert.Equal(t, int64(9), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(3), cur)
data4 := strings.NewReader("zzzzz")
size, _, _ := mem.Store("/foobar1", data4)
assert.Equal(t, int64(5), size)
cur, max = mem.Size()
assert.Equal(t, int64(8), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(2), cur)
}
func TestReplaceUnlimited(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 0,
Purge: false,
})
data := strings.NewReader("xxxxx")
size, created, err := mem.Store("/foobar", data)
assert.Nil(t, err)
assert.Equal(t, int64(5), size)
assert.Equal(t, true, created)
cur, max := mem.Size()
assert.Equal(t, int64(5), cur)
assert.Equal(t, int64(0), max)
cur = mem.Files()
assert.Equal(t, int64(1), cur)
data = strings.NewReader("yyy")
size, created, err = mem.Store("/foobar", data)
assert.Nil(t, err)
assert.Equal(t, int64(3), size)
assert.Equal(t, false, created)
cur, max = mem.Size()
assert.Equal(t, int64(3), cur)
assert.Equal(t, int64(0), max)
cur = mem.Files()
assert.Equal(t, int64(1), cur)
}
func TestTooBigNoPurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
data := strings.NewReader("xxxxxyyyyyz")
size, _, _ := mem.Store("/foobar", data)
assert.Equal(t, int64(-1), size)
}
func TestTooBigPurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: true,
})
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
data := strings.NewReader("xxxxxyyyyyz")
size, _, _ := mem.Store("/foobar", data)
assert.Equal(t, int64(-1), size)
}
func TestFullSpaceNoPurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
cur, max := mem.Size()
assert.Equal(t, int64(10), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(2), cur)
data3 := strings.NewReader("zzzzz")
size, _, _ := mem.Store("/foobar3", data3)
assert.Equal(t, int64(-1), size)
}
func TestFullSpacePurge(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: true,
})
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
cur, max := mem.Size()
assert.Equal(t, int64(10), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(2), cur)
data3 := strings.NewReader("zzzzz")
size, _, _ := mem.Store("/foobar3", data3)
assert.Equal(t, int64(5), size)
cur, max = mem.Size()
assert.Equal(t, int64(10), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(2), cur)
}
func TestFullSpacePurgeMulti(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: true,
})
data1 := strings.NewReader("xxx")
data2 := strings.NewReader("yyy")
data3 := strings.NewReader("zzz")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
mem.Store("/foobar3", data3)
cur, max := mem.Size()
assert.Equal(t, int64(9), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(3), cur)
data4 := strings.NewReader("zzzzz")
size, _, _ := mem.Store("/foobar4", data4)
assert.Equal(t, int64(5), size)
cur, max = mem.Size()
assert.Equal(t, int64(8), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(2), cur)
}
func TestPurgeOrder(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: true,
})
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
data3 := strings.NewReader("zzzzz")
mem.Store("/foobar1", data1)
time.Sleep(1 * time.Second)
mem.Store("/foobar2", data2)
time.Sleep(1 * time.Second)
mem.Store("/foobar3", data3)
file := mem.Open("/foobar1")
assert.Nil(t, file)
}
func TestList(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
data1 := strings.NewReader("a")
data2 := strings.NewReader("bb")
data3 := strings.NewReader("ccc")
data4 := strings.NewReader("dddd")
mem.Store("/foobar1", data1)
mem.Store("/foobar2", data2)
mem.Store("/foobar3", data3)
mem.Store("/foobar4", data4)
cur, max := mem.Size()
assert.Equal(t, int64(10), cur)
assert.Equal(t, int64(10), max)
cur = mem.Files()
assert.Equal(t, int64(4), cur)
files := mem.List("")
assert.Equal(t, 4, len(files))
}
func TestData(t *testing.T) {
mem := NewMemFilesystem(MemConfig{
Size: 10,
Purge: false,
})
data := "gduwotoxqb"
data1 := strings.NewReader(data)
mem.Store("/foobar", data1)
file := mem.Open("/foobar")
data2 := make([]byte, len(data)+1)
n, _ := file.Read(data2)
assert.Equal(t, len(data), n)
assert.Equal(t, []byte(data), data2[:n])
} }

54
io/fs/readonly.go Normal file
View file

@ -0,0 +1,54 @@
package fs
import (
"io"
"os"
)
type readOnlyFilesystem struct {
Filesystem
}
func NewReadOnlyFilesystem(fs Filesystem) (Filesystem, error) {
r := &readOnlyFilesystem{
Filesystem: fs,
}
return r, nil
}
func (r *readOnlyFilesystem) Symlink(oldname, newname string) error {
return os.ErrPermission
}
func (r *readOnlyFilesystem) WriteFileReader(path string, rd io.Reader) (int64, bool, error) {
return -1, false, os.ErrPermission
}
func (r *readOnlyFilesystem) WriteFile(path string, data []byte) (int64, bool, error) {
return -1, false, os.ErrPermission
}
func (r *readOnlyFilesystem) WriteFileSafe(path string, data []byte) (int64, bool, error) {
return -1, false, os.ErrPermission
}
func (r *readOnlyFilesystem) MkdirAll(path string, perm os.FileMode) error {
return os.ErrPermission
}
func (r *readOnlyFilesystem) Remove(path string) int64 {
return -1
}
func (r *readOnlyFilesystem) RemoveAll() int64 {
return 0
}
func (r *readOnlyFilesystem) Purge(size int64) int64 {
return 0
}
func (r *readOnlyFilesystem) Resize(size int64) error {
return os.ErrPermission
}

50
io/fs/readonly_test.go Normal file
View file

@ -0,0 +1,50 @@
package fs
import (
"strings"
"testing"
"github.com/stretchr/testify/require"
)
func TestReadOnly(t *testing.T) {
mem, err := NewMemFilesystemFromDir(".", MemConfig{})
require.NoError(t, err)
ro, err := NewReadOnlyFilesystem(mem)
require.NoError(t, err)
err = ro.Symlink("/readonly.go", "/foobar.go")
require.Error(t, err)
_, _, err = ro.WriteFile("/readonly.go", []byte("foobar"))
require.Error(t, err)
_, _, err = ro.WriteFileReader("/readonly.go", strings.NewReader("foobar"))
require.Error(t, err)
_, _, err = ro.WriteFileSafe("/readonly.go", []byte("foobar"))
require.Error(t, err)
err = ro.MkdirAll("/foobar/baz", 0700)
require.Error(t, err)
res := ro.Remove("/readonly.go")
require.Equal(t, int64(-1), res)
res = ro.RemoveAll()
require.Equal(t, int64(0), res)
rop, ok := ro.(PurgeFilesystem)
require.True(t, ok, "must implement PurgeFilesystem")
size, _ := ro.Size()
res = rop.Purge(size)
require.Equal(t, int64(0), res)
ros, ok := ro.(SizedFilesystem)
require.True(t, ok, "must implement SizedFilesystem")
err = ros.Resize(100)
require.Error(t, err)
}

View file

@ -1,9 +1,15 @@
package fs package fs
import ( import (
"bytes"
"context" "context"
"fmt" "fmt"
"io" "io"
"io/fs"
"os"
"path/filepath"
"strings"
"sync"
"time" "time"
"github.com/datarhei/core/v16/glob" "github.com/datarhei/core/v16/glob"
@ -15,7 +21,6 @@ import (
type S3Config struct { type S3Config struct {
// Namee is the name of the filesystem // Namee is the name of the filesystem
Name string Name string
Base string
Endpoint string Endpoint string
AccessKeyID string AccessKeyID string
SecretAccessKey string SecretAccessKey string
@ -26,9 +31,11 @@ type S3Config struct {
Logger log.Logger Logger log.Logger
} }
type s3fs struct { type s3Filesystem struct {
metadata map[string]string
metaLock sync.RWMutex
name string name string
base string
endpoint string endpoint string
accessKeyID string accessKeyID string
@ -42,10 +49,12 @@ type s3fs struct {
logger log.Logger logger log.Logger
} }
var fakeDirEntry = "..."
func NewS3Filesystem(config S3Config) (Filesystem, error) { func NewS3Filesystem(config S3Config) (Filesystem, error) {
fs := &s3fs{ fs := &s3Filesystem{
metadata: make(map[string]string),
name: config.Name, name: config.Name,
base: config.Base,
endpoint: config.Endpoint, endpoint: config.Endpoint,
accessKeyID: config.AccessKeyID, accessKeyID: config.AccessKeyID,
secretAccessKey: config.SecretAccessKey, secretAccessKey: config.SecretAccessKey,
@ -106,28 +115,32 @@ func NewS3Filesystem(config S3Config) (Filesystem, error) {
return fs, nil return fs, nil
} }
func (fs *s3fs) Name() string { func (fs *s3Filesystem) Name() string {
return fs.name return fs.name
} }
func (fs *s3fs) Base() string { func (fs *s3Filesystem) Type() string {
return fs.base return "s3"
} }
func (fs *s3fs) Rebase(base string) error { func (fs *s3Filesystem) Metadata(key string) string {
fs.base = base fs.metaLock.RLock()
defer fs.metaLock.RUnlock()
return nil return fs.metadata[key]
} }
func (fs *s3fs) Type() string { func (fs *s3Filesystem) SetMetadata(key, data string) {
return "s3fs" fs.metaLock.Lock()
defer fs.metaLock.Unlock()
fs.metadata[key] = data
} }
func (fs *s3fs) Size() (int64, int64) { func (fs *s3Filesystem) Size() (int64, int64) {
size := int64(0) size := int64(0)
files := fs.List("") files := fs.List("/", "")
for _, file := range files { for _, file := range files {
size += file.Size() size += file.Size()
@ -136,14 +149,18 @@ func (fs *s3fs) Size() (int64, int64) {
return size, -1 return size, -1
} }
func (fs *s3fs) Resize(size int64) {} func (fs *s3Filesystem) Files() int64 {
func (fs *s3fs) Files() int64 {
ctx, cancel := context.WithCancel(context.Background()) ctx, cancel := context.WithCancel(context.Background())
defer cancel() defer cancel()
ch := fs.client.ListObjects(ctx, fs.bucket, minio.ListObjectsOptions{ ch := fs.client.ListObjects(ctx, fs.bucket, minio.ListObjectsOptions{
WithVersions: false,
WithMetadata: false,
Prefix: "",
Recursive: true, Recursive: true,
MaxKeys: 0,
StartAfter: "",
UseV1: false,
}) })
nfiles := int64(0) nfiles := int64(0)
@ -152,19 +169,77 @@ func (fs *s3fs) Files() int64 {
if object.Err != nil { if object.Err != nil {
fs.logger.WithError(object.Err).Log("Listing object failed") fs.logger.WithError(object.Err).Log("Listing object failed")
} }
if strings.HasSuffix("/"+object.Key, "/"+fakeDirEntry) {
// Skip fake entries (see MkdirAll)
continue
}
nfiles++ nfiles++
} }
return nfiles return nfiles
} }
func (fs *s3fs) Symlink(oldname, newname string) error { func (fs *s3Filesystem) Symlink(oldname, newname string) error {
return fmt.Errorf("not implemented") return fmt.Errorf("not implemented")
} }
func (fs *s3fs) Open(path string) File { func (fs *s3Filesystem) Stat(path string) (FileInfo, error) {
//ctx, cancel := context.WithCancel(context.Background()) path = fs.cleanPath(path)
//defer cancel()
if len(path) == 0 {
return &s3FileInfo{
name: "/",
size: 0,
dir: true,
lastModified: time.Now(),
}, nil
}
ctx := context.Background()
object, err := fs.client.GetObject(ctx, fs.bucket, path, minio.GetObjectOptions{})
if err != nil {
if fs.isDir(path) {
return &s3FileInfo{
name: "/" + path,
size: 0,
dir: true,
lastModified: time.Now(),
}, nil
}
fs.logger.Debug().WithField("key", path).WithError(err).Log("Not found")
return nil, err
}
defer object.Close()
stat, err := object.Stat()
if err != nil {
if fs.isDir(path) {
return &s3FileInfo{
name: "/" + path,
size: 0,
dir: true,
lastModified: time.Now(),
}, nil
}
fs.logger.Debug().WithField("key", path).WithError(err).Log("Stat failed")
return nil, err
}
return &s3FileInfo{
name: "/" + stat.Key,
size: stat.Size,
lastModified: stat.LastModified,
}, nil
}
func (fs *s3Filesystem) Open(path string) File {
path = fs.cleanPath(path)
ctx := context.Background() ctx := context.Background()
object, err := fs.client.GetObject(ctx, fs.bucket, path, minio.GetObjectOptions{}) object, err := fs.client.GetObject(ctx, fs.bucket, path, minio.GetObjectOptions{})
@ -181,7 +256,7 @@ func (fs *s3fs) Open(path string) File {
file := &s3File{ file := &s3File{
data: object, data: object,
name: stat.Key, name: "/" + stat.Key,
size: stat.Size, size: stat.Size,
lastModified: stat.LastModified, lastModified: stat.LastModified,
} }
@ -191,7 +266,26 @@ func (fs *s3fs) Open(path string) File {
return file return file
} }
func (fs *s3fs) Store(path string, r io.Reader) (int64, bool, error) { func (fs *s3Filesystem) ReadFile(path string) ([]byte, error) {
path = fs.cleanPath(path)
file := fs.Open(path)
if file == nil {
return nil, os.ErrNotExist
}
defer file.Close()
buf := &bytes.Buffer{}
_, err := buf.ReadFrom(file)
if err != nil {
return nil, err
}
return buf.Bytes(), nil
}
func (fs *s3Filesystem) write(path string, r io.Reader) (int64, bool, error) {
ctx, cancel := context.WithCancel(context.Background()) ctx, cancel := context.WithCancel(context.Background())
defer cancel() defer cancel()
@ -234,10 +328,84 @@ func (fs *s3fs) Store(path string, r io.Reader) (int64, bool, error) {
"overwrite": overwrite, "overwrite": overwrite,
}).Log("Stored") }).Log("Stored")
return info.Size, overwrite, nil return info.Size, !overwrite, nil
} }
func (fs *s3fs) Delete(path string) int64 { func (fs *s3Filesystem) WriteFileReader(path string, r io.Reader) (int64, bool, error) {
path = fs.cleanPath(path)
return fs.write(path, r)
}
func (fs *s3Filesystem) WriteFile(path string, data []byte) (int64, bool, error) {
return fs.WriteFileReader(path, bytes.NewBuffer(data))
}
func (fs *s3Filesystem) WriteFileSafe(path string, data []byte) (int64, bool, error) {
return fs.WriteFileReader(path, bytes.NewBuffer(data))
}
func (fs *s3Filesystem) Rename(src, dst string) error {
src = fs.cleanPath(src)
dst = fs.cleanPath(dst)
err := fs.Copy(src, dst)
if err != nil {
return err
}
res := fs.Remove(src)
if res == -1 {
return fmt.Errorf("failed to remove source file: %s", src)
}
return nil
}
func (fs *s3Filesystem) Copy(src, dst string) error {
src = fs.cleanPath(src)
dst = fs.cleanPath(dst)
ctx, cancel := context.WithCancel(context.Background())
defer cancel()
_, err := fs.client.CopyObject(ctx, minio.CopyDestOptions{
Bucket: fs.bucket,
Object: dst,
}, minio.CopySrcOptions{
Bucket: fs.bucket,
Object: src,
})
return err
}
func (fs *s3Filesystem) MkdirAll(path string, perm os.FileMode) error {
if path == "/" {
return nil
}
info, err := fs.Stat(path)
if err == nil {
if !info.IsDir() {
return os.ErrExist
}
return nil
}
path = filepath.Join(path, fakeDirEntry)
_, _, err = fs.write(path, strings.NewReader(""))
if err != nil {
return fmt.Errorf("can't create directory")
}
return nil
}
func (fs *s3Filesystem) Remove(path string) int64 {
path = fs.cleanPath(path)
ctx, cancel := context.WithCancel(context.Background()) ctx, cancel := context.WithCancel(context.Background())
defer cancel() defer cancel()
@ -260,7 +428,7 @@ func (fs *s3fs) Delete(path string) int64 {
return stat.Size return stat.Size
} }
func (fs *s3fs) DeleteAll() int64 { func (fs *s3Filesystem) RemoveAll() int64 {
ctx, cancel := context.WithCancel(context.Background()) ctx, cancel := context.WithCancel(context.Background())
defer cancel() defer cancel()
@ -295,14 +463,16 @@ func (fs *s3fs) DeleteAll() int64 {
return totalSize return totalSize
} }
func (fs *s3fs) List(pattern string) []FileInfo { func (fs *s3Filesystem) List(path, pattern string) []FileInfo {
path = fs.cleanPath(path)
ctx, cancel := context.WithCancel(context.Background()) ctx, cancel := context.WithCancel(context.Background())
defer cancel() defer cancel()
ch := fs.client.ListObjects(ctx, fs.bucket, minio.ListObjectsOptions{ ch := fs.client.ListObjects(ctx, fs.bucket, minio.ListObjectsOptions{
WithVersions: false, WithVersions: false,
WithMetadata: false, WithMetadata: false,
Prefix: "", Prefix: path,
Recursive: true, Recursive: true,
MaxKeys: 0, MaxKeys: 0,
StartAfter: "", StartAfter: "",
@ -317,14 +487,20 @@ func (fs *s3fs) List(pattern string) []FileInfo {
continue continue
} }
key := "/" + object.Key
if strings.HasSuffix(key, "/"+fakeDirEntry) {
// filter out fake directory entries (see MkdirAll)
continue
}
if len(pattern) != 0 { if len(pattern) != 0 {
if ok, _ := glob.Match(pattern, object.Key, '/'); !ok { if ok, _ := glob.Match(pattern, key, '/'); !ok {
continue continue
} }
} }
f := &s3FileInfo{ f := &s3FileInfo{
name: object.Key, name: key,
size: object.Size, size: object.Size,
lastModified: object.LastModified, lastModified: object.LastModified,
} }
@ -335,9 +511,56 @@ func (fs *s3fs) List(pattern string) []FileInfo {
return files return files
} }
func (fs *s3Filesystem) isDir(path string) bool {
if !strings.HasSuffix(path, "/") {
path = path + "/"
}
if path == "/" {
return true
}
ctx, cancel := context.WithCancel(context.Background())
defer cancel()
ch := fs.client.ListObjects(ctx, fs.bucket, minio.ListObjectsOptions{
WithVersions: false,
WithMetadata: false,
Prefix: path,
Recursive: true,
MaxKeys: 1,
StartAfter: "",
UseV1: false,
})
files := uint64(0)
for object := range ch {
if object.Err != nil {
fs.logger.WithError(object.Err).Log("Listing object failed")
continue
}
files++
}
return files > 0
}
func (fs *s3Filesystem) cleanPath(path string) string {
if !filepath.IsAbs(path) {
path = filepath.Join("/", path)
}
path = strings.TrimSuffix(path, "/"+fakeDirEntry)
return filepath.Join("/", filepath.Clean(path))[1:]
}
type s3FileInfo struct { type s3FileInfo struct {
name string name string
size int64 size int64
dir bool
lastModified time.Time lastModified time.Time
} }
@ -349,6 +572,10 @@ func (f *s3FileInfo) Size() int64 {
return f.size return f.size
} }
func (f *s3FileInfo) Mode() os.FileMode {
return fs.FileMode(fs.ModePerm)
}
func (f *s3FileInfo) ModTime() time.Time { func (f *s3FileInfo) ModTime() time.Time {
return f.lastModified return f.lastModified
} }
@ -358,7 +585,7 @@ func (f *s3FileInfo) IsLink() (string, bool) {
} }
func (f *s3FileInfo) IsDir() bool { func (f *s3FileInfo) IsDir() bool {
return false return f.dir
} }
type s3File struct { type s3File struct {

168
io/fs/sized.go Normal file
View file

@ -0,0 +1,168 @@
package fs
import (
"bytes"
"fmt"
"io"
)
type SizedFilesystem interface {
Filesystem
// Resize resizes the filesystem to the new size. Files may need to be deleted.
Resize(size int64) error
}
type PurgeFilesystem interface {
// Purge will free up at least size number of bytes and returns the actual
// freed space in bytes.
Purge(size int64) int64
}
type sizedFilesystem struct {
Filesystem
// Siez is the capacity of the filesystem in bytes
maxSize int64
// Set true to automatically delete the oldest files until there's
// enough space to store a new file
purge bool
}
var _ PurgeFilesystem = &sizedFilesystem{}
func NewSizedFilesystem(fs Filesystem, maxSize int64, purge bool) (SizedFilesystem, error) {
r := &sizedFilesystem{
Filesystem: fs,
maxSize: maxSize,
purge: purge,
}
return r, nil
}
func (r *sizedFilesystem) Size() (int64, int64) {
currentSize, _ := r.Filesystem.Size()
return currentSize, r.maxSize
}
func (r *sizedFilesystem) Resize(size int64) error {
currentSize, _ := r.Size()
if size >= currentSize {
// If the new size is the same or larger than the current size,
// nothing to do.
r.maxSize = size
return nil
}
// If the new size is less than the current size, purge some files.
r.Purge(currentSize - size)
r.maxSize = size
return nil
}
func (r *sizedFilesystem) WriteFileReader(path string, rd io.Reader) (int64, bool, error) {
currentSize, maxSize := r.Size()
if maxSize < 0 {
return r.Filesystem.WriteFileReader(path, rd)
}
data := bytes.Buffer{}
size, err := data.ReadFrom(rd)
if err != nil {
return -1, false, err
}
// reject if the new file is larger than the available space
if size > maxSize {
return -1, false, fmt.Errorf("File is too big")
}
// Calculate the new size of the filesystem
newSize := currentSize + size
// If the the new size is larger than the allowed size, we have to free
// some space.
if newSize > maxSize {
if !r.purge {
return -1, false, fmt.Errorf("not enough space on device")
}
if r.Purge(size) < size {
return -1, false, fmt.Errorf("not enough space on device")
}
}
return r.Filesystem.WriteFileReader(path, &data)
}
func (r *sizedFilesystem) WriteFile(path string, data []byte) (int64, bool, error) {
return r.WriteFileReader(path, bytes.NewBuffer(data))
}
func (r *sizedFilesystem) WriteFileSafe(path string, data []byte) (int64, bool, error) {
currentSize, maxSize := r.Size()
if maxSize < 0 {
return r.Filesystem.WriteFile(path, data)
}
size := int64(len(data))
// reject if the new file is larger than the available space
if size > maxSize {
return -1, false, fmt.Errorf("File is too big")
}
// Calculate the new size of the filesystem
newSize := currentSize + size
// If the the new size is larger than the allowed size, we have to free
// some space.
if newSize > maxSize {
if !r.purge {
return -1, false, fmt.Errorf("not enough space on device")
}
if r.Purge(size) < size {
return -1, false, fmt.Errorf("not enough space on device")
}
}
return r.Filesystem.WriteFileSafe(path, data)
}
func (r *sizedFilesystem) Purge(size int64) int64 {
if purger, ok := r.Filesystem.(PurgeFilesystem); ok {
return purger.Purge(size)
}
return 0
/*
files := r.Filesystem.List("/", "")
sort.Slice(files, func(i, j int) bool {
return files[i].ModTime().Before(files[j].ModTime())
})
var freed int64 = 0
for _, f := range files {
r.Filesystem.Remove(f.Name())
size -= f.Size()
freed += f.Size()
r.currentSize -= f.Size()
if size <= 0 {
break
}
}
files = nil
return freed
*/
}

350
io/fs/sized_test.go Normal file
View file

@ -0,0 +1,350 @@
package fs
import (
"strings"
"testing"
"time"
"github.com/stretchr/testify/require"
)
func newMemFS() Filesystem {
mem, _ := NewMemFilesystem(MemConfig{})
return mem
}
func TestNewSized(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
cur, max := fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(0), cur)
}
func TestSizedResize(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
cur, max := fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(10), max)
err := fs.Resize(20)
require.NoError(t, err)
cur, max = fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(20), max)
}
func TestSizedResizePurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
cur, max := fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(10), max)
fs.WriteFileReader("/foobar", strings.NewReader("xxxxxxxxxx"))
cur, max = fs.Size()
require.Equal(t, int64(10), cur)
require.Equal(t, int64(10), max)
err := fs.Resize(5)
require.NoError(t, err)
cur, max = fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(5), max)
}
func TestSizedWrite(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
cur, max := fs.Size()
require.Equal(t, int64(0), cur)
require.Equal(t, int64(10), max)
size, created, err := fs.WriteFileReader("/foobar", strings.NewReader("xxxxx"))
require.NoError(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max = fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(10), max)
_, _, err = fs.WriteFile("/foobaz", []byte("xxxxxx"))
require.Error(t, err)
_, _, err = fs.WriteFileReader("/foobaz", strings.NewReader("xxxxxx"))
require.Error(t, err)
_, _, err = fs.WriteFileSafe("/foobaz", []byte("xxxxxx"))
require.Error(t, err)
}
func TestSizedReplaceNoPurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
data := strings.NewReader("xxxxx")
size, created, err := fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
data = strings.NewReader("yyy")
size, created, err = fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(3), size)
require.Equal(t, false, created)
cur, max = fs.Size()
require.Equal(t, int64(3), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func TestSizedReplacePurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, true)
data1 := strings.NewReader("xxx")
data2 := strings.NewReader("yyy")
data3 := strings.NewReader("zzz")
fs.WriteFileReader("/foobar1", data1)
fs.WriteFileReader("/foobar2", data2)
fs.WriteFileReader("/foobar3", data3)
cur, max := fs.Size()
require.Equal(t, int64(9), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(3), cur)
data4 := strings.NewReader("zzzzz")
size, _, _ := fs.WriteFileReader("/foobar1", data4)
require.Equal(t, int64(5), size)
cur, max = fs.Size()
require.Equal(t, int64(8), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(2), cur)
}
func TestSizedReplaceUnlimited(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), -1, false)
data := strings.NewReader("xxxxx")
size, created, err := fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(5), size)
require.Equal(t, true, created)
cur, max := fs.Size()
require.Equal(t, int64(5), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
data = strings.NewReader("yyy")
size, created, err = fs.WriteFileReader("/foobar", data)
require.Nil(t, err)
require.Equal(t, int64(3), size)
require.Equal(t, false, created)
cur, max = fs.Size()
require.Equal(t, int64(3), cur)
require.Equal(t, int64(-1), max)
cur = fs.Files()
require.Equal(t, int64(1), cur)
}
func TestSizedTooBigNoPurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
data := strings.NewReader("xxxxxyyyyyz")
size, _, err := fs.WriteFileReader("/foobar", data)
require.Error(t, err)
require.Equal(t, int64(-1), size)
}
func TestSizedTooBigPurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, true)
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
fs.WriteFileReader("/foobar1", data1)
fs.WriteFileReader("/foobar2", data2)
data := strings.NewReader("xxxxxyyyyyz")
size, _, err := fs.WriteFileReader("/foobar", data)
require.Error(t, err)
require.Equal(t, int64(-1), size)
require.Equal(t, int64(2), fs.Files())
}
func TestSizedFullSpaceNoPurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, false)
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
fs.WriteFileReader("/foobar1", data1)
fs.WriteFileReader("/foobar2", data2)
cur, max := fs.Size()
require.Equal(t, int64(10), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(2), cur)
data3 := strings.NewReader("zzzzz")
size, _, err := fs.WriteFileReader("/foobar3", data3)
require.Error(t, err)
require.Equal(t, int64(-1), size)
}
func TestSizedFullSpacePurge(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, true)
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
fs.WriteFileReader("/foobar1", data1)
fs.WriteFileReader("/foobar2", data2)
cur, max := fs.Size()
require.Equal(t, int64(10), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(2), cur)
data3 := strings.NewReader("zzzzz")
size, _, _ := fs.WriteFileReader("/foobar3", data3)
require.Equal(t, int64(5), size)
cur, max = fs.Size()
require.Equal(t, int64(10), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(2), cur)
}
func TestSizedFullSpacePurgeMulti(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, true)
data1 := strings.NewReader("xxx")
data2 := strings.NewReader("yyy")
data3 := strings.NewReader("zzz")
fs.WriteFileReader("/foobar1", data1)
fs.WriteFileReader("/foobar2", data2)
fs.WriteFileReader("/foobar3", data3)
cur, max := fs.Size()
require.Equal(t, int64(9), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(3), cur)
data4 := strings.NewReader("zzzzz")
size, _, _ := fs.WriteFileReader("/foobar4", data4)
require.Equal(t, int64(5), size)
cur, max = fs.Size()
require.Equal(t, int64(8), cur)
require.Equal(t, int64(10), max)
cur = fs.Files()
require.Equal(t, int64(2), cur)
}
func TestSizedPurgeOrder(t *testing.T) {
fs, _ := NewSizedFilesystem(newMemFS(), 10, true)
data1 := strings.NewReader("xxxxx")
data2 := strings.NewReader("yyyyy")
data3 := strings.NewReader("zzzzz")
fs.WriteFileReader("/foobar1", data1)
time.Sleep(1 * time.Second)
fs.WriteFileReader("/foobar2", data2)
time.Sleep(1 * time.Second)
fs.WriteFileReader("/foobar3", data3)
file := fs.Open("/foobar1")
require.Nil(t, file)
}

View file

@ -135,7 +135,7 @@ func (rfs *filesystem) cleanup() {
for _, patterns := range rfs.cleanupPatterns { for _, patterns := range rfs.cleanupPatterns {
for _, pattern := range patterns { for _, pattern := range patterns {
filesAndDirs := rfs.Filesystem.List(pattern.Pattern) filesAndDirs := rfs.Filesystem.List("/", pattern.Pattern)
files := []fs.FileInfo{} files := []fs.FileInfo{}
for _, f := range filesAndDirs { for _, f := range filesAndDirs {
@ -151,7 +151,7 @@ func (rfs *filesystem) cleanup() {
if pattern.MaxFiles > 0 && uint(len(files)) > pattern.MaxFiles { if pattern.MaxFiles > 0 && uint(len(files)) > pattern.MaxFiles {
for i := uint(0); i < uint(len(files))-pattern.MaxFiles; i++ { for i := uint(0); i < uint(len(files))-pattern.MaxFiles; i++ {
rfs.logger.Debug().WithField("path", files[i].Name()).Log("Remove file because MaxFiles is exceeded") rfs.logger.Debug().WithField("path", files[i].Name()).Log("Remove file because MaxFiles is exceeded")
rfs.Filesystem.Delete(files[i].Name()) rfs.Filesystem.Remove(files[i].Name())
} }
} }
@ -161,7 +161,7 @@ func (rfs *filesystem) cleanup() {
for _, f := range files { for _, f := range files {
if f.ModTime().Before(bestBefore) { if f.ModTime().Before(bestBefore) {
rfs.logger.Debug().WithField("path", f.Name()).Log("Remove file because MaxFileAge is exceeded") rfs.logger.Debug().WithField("path", f.Name()).Log("Remove file because MaxFileAge is exceeded")
rfs.Filesystem.Delete(f.Name()) rfs.Filesystem.Remove(f.Name())
} }
} }
} }
@ -175,11 +175,11 @@ func (rfs *filesystem) purge(patterns []Pattern) (nfiles uint64) {
continue continue
} }
files := rfs.Filesystem.List(pattern.Pattern) files := rfs.Filesystem.List("/", pattern.Pattern)
sort.Slice(files, func(i, j int) bool { return len(files[i].Name()) > len(files[j].Name()) }) sort.Slice(files, func(i, j int) bool { return len(files[i].Name()) > len(files[j].Name()) })
for _, f := range files { for _, f := range files {
rfs.logger.Debug().WithField("path", f.Name()).Log("Purging file") rfs.logger.Debug().WithField("path", f.Name()).Log("Purging file")
rfs.Filesystem.Delete(f.Name()) rfs.Filesystem.Remove(f.Name())
nfiles++ nfiles++
} }
} }

View file

@ -10,11 +10,7 @@ import (
) )
func TestMaxFiles(t *testing.T) { func TestMaxFiles(t *testing.T) {
memfs := fs.NewMemFilesystem(fs.MemConfig{ memfs, _ := fs.NewMemFilesystem(fs.MemConfig{})
Base: "/",
Size: 1024,
Purge: false,
})
cleanfs := New(Config{ cleanfs := New(Config{
FS: memfs, FS: memfs,
@ -30,15 +26,15 @@ func TestMaxFiles(t *testing.T) {
}, },
}) })
cleanfs.Store("/chunk_0.ts", strings.NewReader("chunk_0")) cleanfs.WriteFileReader("/chunk_0.ts", strings.NewReader("chunk_0"))
cleanfs.Store("/chunk_1.ts", strings.NewReader("chunk_1")) cleanfs.WriteFileReader("/chunk_1.ts", strings.NewReader("chunk_1"))
cleanfs.Store("/chunk_2.ts", strings.NewReader("chunk_2")) cleanfs.WriteFileReader("/chunk_2.ts", strings.NewReader("chunk_2"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
return cleanfs.Files() == 3 return cleanfs.Files() == 3
}, 3*time.Second, time.Second) }, 3*time.Second, time.Second)
cleanfs.Store("/chunk_3.ts", strings.NewReader("chunk_3")) cleanfs.WriteFileReader("/chunk_3.ts", strings.NewReader("chunk_3"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
if cleanfs.Files() != 3 { if cleanfs.Files() != 3 {
@ -47,7 +43,7 @@ func TestMaxFiles(t *testing.T) {
names := []string{} names := []string{}
for _, f := range cleanfs.List("/*.ts") { for _, f := range cleanfs.List("/", "/*.ts") {
names = append(names, f.Name()) names = append(names, f.Name())
} }
@ -60,11 +56,7 @@ func TestMaxFiles(t *testing.T) {
} }
func TestMaxAge(t *testing.T) { func TestMaxAge(t *testing.T) {
memfs := fs.NewMemFilesystem(fs.MemConfig{ memfs, _ := fs.NewMemFilesystem(fs.MemConfig{})
Base: "/",
Size: 1024,
Purge: false,
})
cleanfs := New(Config{ cleanfs := New(Config{
FS: memfs, FS: memfs,
@ -80,15 +72,15 @@ func TestMaxAge(t *testing.T) {
}, },
}) })
cleanfs.Store("/chunk_0.ts", strings.NewReader("chunk_0")) cleanfs.WriteFileReader("/chunk_0.ts", strings.NewReader("chunk_0"))
cleanfs.Store("/chunk_1.ts", strings.NewReader("chunk_1")) cleanfs.WriteFileReader("/chunk_1.ts", strings.NewReader("chunk_1"))
cleanfs.Store("/chunk_2.ts", strings.NewReader("chunk_2")) cleanfs.WriteFileReader("/chunk_2.ts", strings.NewReader("chunk_2"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
return cleanfs.Files() == 0 return cleanfs.Files() == 0
}, 5*time.Second, time.Second) }, 5*time.Second, time.Second)
cleanfs.Store("/chunk_3.ts", strings.NewReader("chunk_3")) cleanfs.WriteFileReader("/chunk_3.ts", strings.NewReader("chunk_3"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
if cleanfs.Files() != 1 { if cleanfs.Files() != 1 {
@ -97,7 +89,7 @@ func TestMaxAge(t *testing.T) {
names := []string{} names := []string{}
for _, f := range cleanfs.List("/*.ts") { for _, f := range cleanfs.List("/", "/*.ts") {
names = append(names, f.Name()) names = append(names, f.Name())
} }
@ -110,11 +102,7 @@ func TestMaxAge(t *testing.T) {
} }
func TestUnsetCleanup(t *testing.T) { func TestUnsetCleanup(t *testing.T) {
memfs := fs.NewMemFilesystem(fs.MemConfig{ memfs, _ := fs.NewMemFilesystem(fs.MemConfig{})
Base: "/",
Size: 1024,
Purge: false,
})
cleanfs := New(Config{ cleanfs := New(Config{
FS: memfs, FS: memfs,
@ -130,15 +118,15 @@ func TestUnsetCleanup(t *testing.T) {
}, },
}) })
cleanfs.Store("/chunk_0.ts", strings.NewReader("chunk_0")) cleanfs.WriteFileReader("/chunk_0.ts", strings.NewReader("chunk_0"))
cleanfs.Store("/chunk_1.ts", strings.NewReader("chunk_1")) cleanfs.WriteFileReader("/chunk_1.ts", strings.NewReader("chunk_1"))
cleanfs.Store("/chunk_2.ts", strings.NewReader("chunk_2")) cleanfs.WriteFileReader("/chunk_2.ts", strings.NewReader("chunk_2"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
return cleanfs.Files() == 3 return cleanfs.Files() == 3
}, 3*time.Second, time.Second) }, 3*time.Second, time.Second)
cleanfs.Store("/chunk_3.ts", strings.NewReader("chunk_3")) cleanfs.WriteFileReader("/chunk_3.ts", strings.NewReader("chunk_3"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
if cleanfs.Files() != 3 { if cleanfs.Files() != 3 {
@ -147,7 +135,7 @@ func TestUnsetCleanup(t *testing.T) {
names := []string{} names := []string{}
for _, f := range cleanfs.List("/*.ts") { for _, f := range cleanfs.List("/", "/*.ts") {
names = append(names, f.Name()) names = append(names, f.Name())
} }
@ -158,7 +146,7 @@ func TestUnsetCleanup(t *testing.T) {
cleanfs.UnsetCleanup("foobar") cleanfs.UnsetCleanup("foobar")
cleanfs.Store("/chunk_4.ts", strings.NewReader("chunk_4")) cleanfs.WriteFileReader("/chunk_4.ts", strings.NewReader("chunk_4"))
require.Eventually(t, func() bool { require.Eventually(t, func() bool {
if cleanfs.Files() != 4 { if cleanfs.Files() != 4 {
@ -167,7 +155,7 @@ func TestUnsetCleanup(t *testing.T) {
names := []string{} names := []string{}
for _, f := range cleanfs.List("/*.ts") { for _, f := range cleanfs.List("/", "/*.ts") {
names = append(names, f.Name()) names = append(names, f.Name())
} }

View file

@ -124,7 +124,14 @@ func New(config Config) (Restreamer, error) {
} }
if r.store == nil { if r.store == nil {
r.store = store.NewDummyStore(store.DummyConfig{}) dummyfs, _ := fs.NewMemFilesystem(fs.MemConfig{})
s, err := store.NewJSON(store.JSONConfig{
Filesystem: dummyfs,
})
if err != nil {
return nil, err
}
r.store = s
} }
for _, fs := range config.Filesystems { for _, fs := range config.Filesystems {
@ -136,7 +143,7 @@ func New(config Config) (Restreamer, error) {
r.fs.list = append(r.fs.list, fs) r.fs.list = append(r.fs.list, fs)
// Add the diskfs filesystems also to a separate array. We need it later for input and output validation // Add the diskfs filesystems also to a separate array. We need it later for input and output validation
if fs.Type() == "diskfs" { if fs.Type() == "disk" {
r.fs.diskfs = append(r.fs.diskfs, fs) r.fs.diskfs = append(r.fs.diskfs, fs)
} }
} }
@ -183,7 +190,7 @@ func (r *restream) Start() {
for _, fs := range r.fs.list { for _, fs := range r.fs.list {
fs.Start() fs.Start()
if fs.Type() == "diskfs" { if fs.Type() == "disk" {
go r.observe(ctx, fs, 10*time.Second) go r.observe(ctx, fs, 10*time.Second)
} }
} }
@ -635,7 +642,7 @@ func (r *restream) validateConfig(config *app.Config) (bool, error) {
if len(r.fs.diskfs) != 0 { if len(r.fs.diskfs) != 0 {
maxFails := 0 maxFails := 0
for _, fs := range r.fs.diskfs { for _, fs := range r.fs.diskfs {
io.Address, err = r.validateInputAddress(io.Address, fs.Base()) io.Address, err = r.validateInputAddress(io.Address, fs.Metadata("base"))
if err != nil { if err != nil {
maxFails++ maxFails++
} }
@ -682,7 +689,7 @@ func (r *restream) validateConfig(config *app.Config) (bool, error) {
maxFails := 0 maxFails := 0
for _, fs := range r.fs.diskfs { for _, fs := range r.fs.diskfs {
isFile := false isFile := false
io.Address, isFile, err = r.validateOutputAddress(io.Address, fs.Base()) io.Address, isFile, err = r.validateOutputAddress(io.Address, fs.Metadata("base"))
if err != nil { if err != nil {
maxFails++ maxFails++
} }

View file

@ -1,37 +0,0 @@
package store
import (
"github.com/datarhei/core/v16/log"
)
type DummyConfig struct {
Logger log.Logger
}
type dummyStore struct {
logger log.Logger
}
func NewDummyStore(config DummyConfig) Store {
s := &dummyStore{
logger: config.Logger,
}
if s.logger == nil {
s.logger = log.New("")
}
return s
}
func (sb *dummyStore) Store(data StoreData) error {
sb.logger.Debug().Log("Data stored")
return nil
}
func (sb *dummyStore) Load() (StoreData, error) {
sb.logger.Debug().Log("Data loaded")
return NewStoreData(), nil
}

View file

@ -4,23 +4,22 @@ import (
gojson "encoding/json" gojson "encoding/json"
"fmt" "fmt"
"os" "os"
"path"
"sync" "sync"
"github.com/datarhei/core/v16/encoding/json" "github.com/datarhei/core/v16/encoding/json"
"github.com/datarhei/core/v16/io/file" "github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
) )
type JSONConfig struct { type JSONConfig struct {
Filepath string Filesystem fs.Filesystem
FFVersion string Filepath string // Full path to the database file
Logger log.Logger Logger log.Logger
} }
type jsonStore struct { type jsonStore struct {
fs fs.Filesystem
filepath string filepath string
ffversion string
logger log.Logger logger log.Logger
// Mutex to serialize access to the backend // Mutex to serialize access to the backend
@ -29,18 +28,26 @@ type jsonStore struct {
var version uint64 = 4 var version uint64 = 4
func NewJSONStore(config JSONConfig) Store { func NewJSON(config JSONConfig) (Store, error) {
s := &jsonStore{ s := &jsonStore{
fs: config.Filesystem,
filepath: config.Filepath, filepath: config.Filepath,
ffversion: config.FFVersion,
logger: config.Logger, logger: config.Logger,
} }
if len(s.filepath) == 0 {
s.filepath = "/db.json"
}
if s.fs == nil {
return nil, fmt.Errorf("no valid filesystem provided")
}
if s.logger == nil { if s.logger == nil {
s.logger = log.New("") s.logger = log.New("")
} }
return s return s, nil
} }
func (s *jsonStore) Load() (StoreData, error) { func (s *jsonStore) Load() (StoreData, error) {
@ -79,28 +86,11 @@ func (s *jsonStore) store(filepath string, data StoreData) error {
return err return err
} }
dir := path.Dir(filepath) _, _, err = s.fs.WriteFileSafe(filepath, jsondata)
name := path.Base(filepath)
tmpfile, err := os.CreateTemp(dir, name)
if err != nil { if err != nil {
return err return err
} }
defer os.Remove(tmpfile.Name())
if _, err := tmpfile.Write(jsondata); err != nil {
return err
}
if err := tmpfile.Close(); err != nil {
return err
}
if err := file.Rename(tmpfile.Name(), filepath); err != nil {
return err
}
s.logger.WithField("file", filepath).Debug().Log("Stored data") s.logger.WithField("file", filepath).Debug().Log("Stored data")
return nil return nil
@ -113,7 +103,7 @@ type storeVersion struct {
func (s *jsonStore) load(filepath string, version uint64) (StoreData, error) { func (s *jsonStore) load(filepath string, version uint64) (StoreData, error) {
r := NewStoreData() r := NewStoreData()
_, err := os.Stat(filepath) _, err := s.fs.Stat(filepath)
if err != nil { if err != nil {
if os.IsNotExist(err) { if os.IsNotExist(err) {
return r, nil return r, nil
@ -122,7 +112,7 @@ func (s *jsonStore) load(filepath string, version uint64) (StoreData, error) {
return r, err return r, err
} }
jsondata, err := os.ReadFile(filepath) jsondata, err := s.fs.ReadFile(filepath)
if err != nil { if err != nil {
return r, err return r, err
} }

View file

@ -1,40 +1,61 @@
package store package store
import ( import (
"os"
"testing" "testing"
"github.com/datarhei/core/v16/io/fs"
"github.com/stretchr/testify/require" "github.com/stretchr/testify/require"
) )
func TestNew(t *testing.T) { func getFS(t *testing.T) fs.Filesystem {
store := NewJSONStore(JSONConfig{}) fs, err := fs.NewRootedDiskFilesystem(fs.RootedDiskConfig{
Root: ".",
})
require.NoError(t, err)
info, err := fs.Stat("./fixtures/v4_empty.json")
require.NoError(t, err)
require.Equal(t, "/fixtures/v4_empty.json", info.Name())
return fs
}
func TestNew(t *testing.T) {
store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
})
require.NoError(t, err)
require.NotEmpty(t, store) require.NotEmpty(t, store)
} }
func TestLoad(t *testing.T) { func TestLoad(t *testing.T) {
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
Filepath: "./fixtures/v4_empty.json", Filepath: "./fixtures/v4_empty.json",
}) })
require.NoError(t, err)
_, err := store.Load() _, err = store.Load()
require.Equal(t, nil, err) require.NoError(t, err)
} }
func TestLoadFailed(t *testing.T) { func TestLoadFailed(t *testing.T) {
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
Filepath: "./fixtures/v4_invalid.json", Filepath: "./fixtures/v4_invalid.json",
}) })
require.NoError(t, err)
_, err := store.Load() _, err = store.Load()
require.NotEqual(t, nil, err) require.Error(t, err)
} }
func TestIsEmpty(t *testing.T) { func TestIsEmpty(t *testing.T) {
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
Filepath: "./fixtures/v4_empty.json", Filepath: "./fixtures/v4_empty.json",
}) })
require.NoError(t, err)
data, err := store.Load() data, err := store.Load()
require.NoError(t, err) require.NoError(t, err)
@ -42,9 +63,11 @@ func TestIsEmpty(t *testing.T) {
} }
func TestNotExists(t *testing.T) { func TestNotExists(t *testing.T) {
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
Filepath: "./fixtures/v4_notexist.json", Filepath: "./fixtures/v4_notexist.json",
}) })
require.NoError(t, err)
data, err := store.Load() data, err := store.Load()
require.NoError(t, err) require.NoError(t, err)
@ -52,11 +75,14 @@ func TestNotExists(t *testing.T) {
} }
func TestStore(t *testing.T) { func TestStore(t *testing.T) {
os.Remove("./fixtures/v4_store.json") fs := getFS(t)
fs.Remove("./fixtures/v4_store.json")
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: fs,
Filepath: "./fixtures/v4_store.json", Filepath: "./fixtures/v4_store.json",
}) })
require.NoError(t, err)
data, err := store.Load() data, err := store.Load()
require.NoError(t, err) require.NoError(t, err)
@ -70,13 +96,15 @@ func TestStore(t *testing.T) {
require.NoError(t, err) require.NoError(t, err)
require.Equal(t, data, data2) require.Equal(t, data, data2)
os.Remove("./fixtures/v4_store.json") fs.Remove("./fixtures/v4_store.json")
} }
func TestInvalidVersion(t *testing.T) { func TestInvalidVersion(t *testing.T) {
store := NewJSONStore(JSONConfig{ store, err := NewJSON(JSONConfig{
Filesystem: getFS(t),
Filepath: "./fixtures/v3_empty.json", Filepath: "./fixtures/v3_empty.json",
}) })
require.NoError(t, err)
data, err := store.Load() data, err := store.Load()
require.Error(t, err) require.Error(t, err)

View file

@ -3,13 +3,11 @@ package session
import ( import (
"context" "context"
"encoding/json" "encoding/json"
"os"
"path/filepath"
"sort" "sort"
"sync" "sync"
"time" "time"
"github.com/datarhei/core/v16/io/file" "github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
"github.com/datarhei/core/v16/net" "github.com/datarhei/core/v16/net"
@ -244,6 +242,7 @@ type collector struct {
persist struct { persist struct {
enable bool enable bool
fs fs.Filesystem
path string path string
interval time.Duration interval time.Duration
done context.CancelFunc done context.CancelFunc
@ -275,7 +274,7 @@ const (
// NewCollector returns a new collector according to the provided configuration. If such a // NewCollector returns a new collector according to the provided configuration. If such a
// collector can't be created, a NullCollector is returned. // collector can't be created, a NullCollector is returned.
func NewCollector(config CollectorConfig) Collector { func NewCollector(config CollectorConfig) Collector {
collector, err := newCollector("", "", nil, config) collector, err := newCollector("", nil, nil, config)
if err != nil { if err != nil {
return NewNullCollector() return NewNullCollector()
} }
@ -285,7 +284,7 @@ func NewCollector(config CollectorConfig) Collector {
return collector return collector
} }
func newCollector(id, persistPath string, logger log.Logger, config CollectorConfig) (*collector, error) { func newCollector(id string, persistFS fs.Filesystem, logger log.Logger, config CollectorConfig) (*collector, error) {
c := &collector{ c := &collector{
maxRxBitrate: float64(config.MaxRxBitrate), maxRxBitrate: float64(config.MaxRxBitrate),
maxTxBitrate: float64(config.MaxTxBitrate), maxTxBitrate: float64(config.MaxTxBitrate),
@ -379,11 +378,12 @@ func newCollector(id, persistPath string, logger log.Logger, config CollectorCon
c.history.Sessions = make(map[string]totals) c.history.Sessions = make(map[string]totals)
c.persist.enable = len(persistPath) != 0 c.persist.enable = persistFS != nil
c.persist.path = persistPath c.persist.fs = persistFS
c.persist.path = "/" + id + ".json"
c.persist.interval = config.PersistInterval c.persist.interval = config.PersistInterval
c.loadHistory(c.persist.path, &c.history) c.loadHistory(c.persist.fs, c.persist.path, &c.history)
c.stopOnce.Do(func() {}) c.stopOnce.Do(func() {})
@ -433,7 +433,7 @@ func (c *collector) Persist() {
c.lock.history.RLock() c.lock.history.RLock()
defer c.lock.history.RUnlock() defer c.lock.history.RUnlock()
c.saveHistory(c.persist.path, &c.history) c.saveHistory(c.persist.fs, c.persist.path, &c.history)
} }
func (c *collector) persister(ctx context.Context, interval time.Duration) { func (c *collector) persister(ctx context.Context, interval time.Duration) {
@ -450,17 +450,20 @@ func (c *collector) persister(ctx context.Context, interval time.Duration) {
} }
} }
func (c *collector) loadHistory(path string, data *history) { func (c *collector) loadHistory(fs fs.Filesystem, path string, data *history) {
c.logger.WithComponent("SessionStore").WithField("path", path).Debug().Log("Loading history") if fs == nil {
if len(path) == 0 {
return return
} }
c.logger.WithComponent("SessionStore").WithFields(log.Fields{
"base": fs.Metadata("base"),
"path": path,
}).Debug().Log("Loading history")
c.lock.persist.Lock() c.lock.persist.Lock()
defer c.lock.persist.Unlock() defer c.lock.persist.Unlock()
jsondata, err := os.ReadFile(path) jsondata, err := fs.ReadFile(path)
if err != nil { if err != nil {
return return
} }
@ -470,12 +473,15 @@ func (c *collector) loadHistory(path string, data *history) {
} }
} }
func (c *collector) saveHistory(path string, data *history) { func (c *collector) saveHistory(fs fs.Filesystem, path string, data *history) {
if len(path) == 0 { if fs == nil {
return return
} }
c.logger.WithComponent("SessionStore").WithField("path", path).Debug().Log("Storing history") c.logger.WithComponent("SessionStore").WithFields(log.Fields{
"base": fs.Metadata("base"),
"path": path,
}).Debug().Log("Storing history")
c.lock.persist.Lock() c.lock.persist.Lock()
defer c.lock.persist.Unlock() defer c.lock.persist.Unlock()
@ -485,27 +491,10 @@ func (c *collector) saveHistory(path string, data *history) {
return return
} }
dir := filepath.Dir(path) _, _, err = fs.WriteFileSafe(path, jsondata)
filename := filepath.Base(path)
tmpfile, err := os.CreateTemp(dir, filename)
if err != nil { if err != nil {
return return
} }
defer os.Remove(tmpfile.Name())
if _, err := tmpfile.Write(jsondata); err != nil {
return
}
if err := tmpfile.Close(); err != nil {
return
}
if err := file.Rename(tmpfile.Name(), path); err != nil {
return
}
} }
func (c *collector) IsCollectableIP(ip string) bool { func (c *collector) IsCollectableIP(ip string) bool {

View file

@ -8,7 +8,7 @@ import (
) )
func TestRegisterSession(t *testing.T) { func TestRegisterSession(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Hour, InactiveTimeout: time.Hour,
SessionTimeout: time.Hour, SessionTimeout: time.Hour,
}) })
@ -31,7 +31,7 @@ func TestRegisterSession(t *testing.T) {
} }
func TestInactiveSession(t *testing.T) { func TestInactiveSession(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Second, InactiveTimeout: time.Second,
SessionTimeout: time.Hour, SessionTimeout: time.Hour,
}) })
@ -52,7 +52,7 @@ func TestInactiveSession(t *testing.T) {
} }
func TestActivateSession(t *testing.T) { func TestActivateSession(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Second, InactiveTimeout: time.Second,
SessionTimeout: time.Second, SessionTimeout: time.Second,
}) })
@ -73,7 +73,7 @@ func TestActivateSession(t *testing.T) {
} }
func TestIngress(t *testing.T) { func TestIngress(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Second, InactiveTimeout: time.Second,
SessionTimeout: time.Hour, SessionTimeout: time.Hour,
}) })
@ -92,7 +92,7 @@ func TestIngress(t *testing.T) {
} }
func TestEgress(t *testing.T) { func TestEgress(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Second, InactiveTimeout: time.Second,
SessionTimeout: time.Hour, SessionTimeout: time.Hour,
}) })
@ -111,7 +111,7 @@ func TestEgress(t *testing.T) {
} }
func TestNbSessions(t *testing.T) { func TestNbSessions(t *testing.T) {
c, err := newCollector("", "", nil, CollectorConfig{ c, err := newCollector("", nil, nil, CollectorConfig{
InactiveTimeout: time.Hour, InactiveTimeout: time.Hour,
SessionTimeout: time.Hour, SessionTimeout: time.Hour,
}) })

View file

@ -2,20 +2,18 @@ package session
import ( import (
"fmt" "fmt"
"os"
"path/filepath"
"regexp" "regexp"
"sync" "sync"
"github.com/datarhei/core/v16/io/fs"
"github.com/datarhei/core/v16/log" "github.com/datarhei/core/v16/log"
) )
// Config is the configuration for creating a new registry // Config is the configuration for creating a new registry
type Config struct { type Config struct {
// PersistDir is a path to the directory where the session // PersistFS is a filesystem in whose root the session history will be persisted. If it is nil, the
// history will be persisted. If it is an empty value, the
// history will not be persisted. // history will not be persisted.
PersistDir string PersistFS fs.Filesystem
// Logger is an instance of a logger. If it is nil, no logs // Logger is an instance of a logger. If it is nil, no logs
// will be written. // will be written.
@ -53,7 +51,7 @@ type Registry interface {
type registry struct { type registry struct {
collector map[string]*collector collector map[string]*collector
persistDir string persistFS fs.Filesystem
logger log.Logger logger log.Logger
lock sync.Mutex lock sync.Mutex
@ -64,7 +62,7 @@ type registry struct {
func New(conf Config) (Registry, error) { func New(conf Config) (Registry, error) {
r := &registry{ r := &registry{
collector: make(map[string]*collector), collector: make(map[string]*collector),
persistDir: conf.PersistDir, persistFS: conf.PersistFS,
logger: conf.Logger, logger: conf.Logger,
} }
@ -72,12 +70,6 @@ func New(conf Config) (Registry, error) {
r.logger = log.New("Session") r.logger = log.New("Session")
} }
if len(r.persistDir) != 0 {
if err := os.MkdirAll(r.persistDir, 0700); err != nil {
return nil, err
}
}
return r, nil return r, nil
} }
@ -99,12 +91,7 @@ func (r *registry) Register(id string, conf CollectorConfig) (Collector, error)
return nil, fmt.Errorf("a collector with the ID '%s' already exists", id) return nil, fmt.Errorf("a collector with the ID '%s' already exists", id)
} }
persistPath := "" m, err := newCollector(id, r.persistFS, r.logger, conf)
if len(r.persistDir) != 0 {
persistPath = filepath.Join(r.persistDir, id+".json")
}
m, err := newCollector(id, persistPath, r.logger, conf)
if err != nil { if err != nil {
return nil, err return nil, err
} }

View file

@ -3,8 +3,7 @@
[![Go Reference](https://pkg.go.dev/badge/github.com/cespare/xxhash/v2.svg)](https://pkg.go.dev/github.com/cespare/xxhash/v2) [![Go Reference](https://pkg.go.dev/badge/github.com/cespare/xxhash/v2.svg)](https://pkg.go.dev/github.com/cespare/xxhash/v2)
[![Test](https://github.com/cespare/xxhash/actions/workflows/test.yml/badge.svg)](https://github.com/cespare/xxhash/actions/workflows/test.yml) [![Test](https://github.com/cespare/xxhash/actions/workflows/test.yml/badge.svg)](https://github.com/cespare/xxhash/actions/workflows/test.yml)
xxhash is a Go implementation of the 64-bit xxhash is a Go implementation of the 64-bit [xxHash] algorithm, XXH64. This is a
[xxHash](http://cyan4973.github.io/xxHash/) algorithm, XXH64. This is a
high-quality hashing algorithm that is much faster than anything in the Go high-quality hashing algorithm that is much faster than anything in the Go
standard library. standard library.
@ -25,8 +24,11 @@ func (*Digest) WriteString(string) (int, error)
func (*Digest) Sum64() uint64 func (*Digest) Sum64() uint64
``` ```
This implementation provides a fast pure-Go implementation and an even faster The package is written with optimized pure Go and also contains even faster
assembly implementation for amd64. assembly implementations for amd64 and arm64. If desired, the `purego` build tag
opts into using the Go code even on those architectures.
[xxHash]: http://cyan4973.github.io/xxHash/
## Compatibility ## Compatibility
@ -46,18 +48,19 @@ Here are some quick benchmarks comparing the pure-Go and assembly
implementations of Sum64. implementations of Sum64.
| input size | purego | asm | | input size | purego | asm |
| --- | --- | --- | | ---------- | --------- | --------- |
| 5 B | 979.66 MB/s | 1291.17 MB/s | | 4 B | 1.3 GB/s | 1.2 GB/s |
| 100 B | 7475.26 MB/s | 7973.40 MB/s | | 16 B | 2.9 GB/s | 3.5 GB/s |
| 4 KB | 17573.46 MB/s | 17602.65 MB/s | | 100 B | 6.9 GB/s | 8.1 GB/s |
| 10 MB | 17131.46 MB/s | 17142.16 MB/s | | 4 KB | 11.7 GB/s | 16.7 GB/s |
| 10 MB | 12.0 GB/s | 17.3 GB/s |
These numbers were generated on Ubuntu 18.04 with an Intel i7-8700K CPU using These numbers were generated on Ubuntu 20.04 with an Intel Xeon Platinum 8252C
the following commands under Go 1.11.2: CPU using the following commands under Go 1.19.2:
``` ```
$ go test -tags purego -benchtime 10s -bench '/xxhash,direct,bytes' benchstat <(go test -tags purego -benchtime 500ms -count 15 -bench 'Sum64$')
$ go test -benchtime 10s -bench '/xxhash,direct,bytes' benchstat <(go test -benchtime 500ms -count 15 -bench 'Sum64$')
``` ```
## Projects using this package ## Projects using this package

10
vendor/github.com/cespare/xxhash/v2/testall.sh generated vendored Normal file
View file

@ -0,0 +1,10 @@
#!/bin/bash
set -eu -o pipefail
# Small convenience script for running the tests with various combinations of
# arch/tags. This assumes we're running on amd64 and have qemu available.
go test ./...
go test -tags purego ./...
GOARCH=arm64 go test
GOARCH=arm64 go test -tags purego

View file

@ -16,19 +16,11 @@ const (
prime5 uint64 = 2870177450012600261 prime5 uint64 = 2870177450012600261
) )
// NOTE(caleb): I'm using both consts and vars of the primes. Using consts where // Store the primes in an array as well.
// possible in the Go code is worth a small (but measurable) performance boost //
// by avoiding some MOVQs. Vars are needed for the asm and also are useful for // The consts are used when possible in Go code to avoid MOVs but we need a
// convenience in the Go code in a few places where we need to intentionally // contiguous array of the assembly code.
// avoid constant arithmetic (e.g., v1 := prime1 + prime2 fails because the var primes = [...]uint64{prime1, prime2, prime3, prime4, prime5}
// result overflows a uint64).
var (
prime1v = prime1
prime2v = prime2
prime3v = prime3
prime4v = prime4
prime5v = prime5
)
// Digest implements hash.Hash64. // Digest implements hash.Hash64.
type Digest struct { type Digest struct {
@ -50,10 +42,10 @@ func New() *Digest {
// Reset clears the Digest's state so that it can be reused. // Reset clears the Digest's state so that it can be reused.
func (d *Digest) Reset() { func (d *Digest) Reset() {
d.v1 = prime1v + prime2 d.v1 = primes[0] + prime2
d.v2 = prime2 d.v2 = prime2
d.v3 = 0 d.v3 = 0
d.v4 = -prime1v d.v4 = -primes[0]
d.total = 0 d.total = 0
d.n = 0 d.n = 0
} }
@ -69,21 +61,23 @@ func (d *Digest) Write(b []byte) (n int, err error) {
n = len(b) n = len(b)
d.total += uint64(n) d.total += uint64(n)
memleft := d.mem[d.n&(len(d.mem)-1):]
if d.n+n < 32 { if d.n+n < 32 {
// This new data doesn't even fill the current block. // This new data doesn't even fill the current block.
copy(d.mem[d.n:], b) copy(memleft, b)
d.n += n d.n += n
return return
} }
if d.n > 0 { if d.n > 0 {
// Finish off the partial block. // Finish off the partial block.
copy(d.mem[d.n:], b) c := copy(memleft, b)
d.v1 = round(d.v1, u64(d.mem[0:8])) d.v1 = round(d.v1, u64(d.mem[0:8]))
d.v2 = round(d.v2, u64(d.mem[8:16])) d.v2 = round(d.v2, u64(d.mem[8:16]))
d.v3 = round(d.v3, u64(d.mem[16:24])) d.v3 = round(d.v3, u64(d.mem[16:24]))
d.v4 = round(d.v4, u64(d.mem[24:32])) d.v4 = round(d.v4, u64(d.mem[24:32]))
b = b[32-d.n:] b = b[c:]
d.n = 0 d.n = 0
} }
@ -133,21 +127,20 @@ func (d *Digest) Sum64() uint64 {
h += d.total h += d.total
i, end := 0, d.n b := d.mem[:d.n&(len(d.mem)-1)]
for ; i+8 <= end; i += 8 { for ; len(b) >= 8; b = b[8:] {
k1 := round(0, u64(d.mem[i:i+8])) k1 := round(0, u64(b[:8]))
h ^= k1 h ^= k1
h = rol27(h)*prime1 + prime4 h = rol27(h)*prime1 + prime4
} }
if i+4 <= end { if len(b) >= 4 {
h ^= uint64(u32(d.mem[i:i+4])) * prime1 h ^= uint64(u32(b[:4])) * prime1
h = rol23(h)*prime2 + prime3 h = rol23(h)*prime2 + prime3
i += 4 b = b[4:]
} }
for i < end { for ; len(b) > 0; b = b[1:] {
h ^= uint64(d.mem[i]) * prime5 h ^= uint64(b[0]) * prime5
h = rol11(h) * prime1 h = rol11(h) * prime1
i++
} }
h ^= h >> 33 h ^= h >> 33

View file

@ -1,215 +1,209 @@
//go:build !appengine && gc && !purego
// +build !appengine // +build !appengine
// +build gc // +build gc
// +build !purego // +build !purego
#include "textflag.h" #include "textflag.h"
// Register allocation: // Registers:
// AX h #define h AX
// SI pointer to advance through b #define d AX
// DX n #define p SI // pointer to advance through b
// BX loop end #define n DX
// R8 v1, k1 #define end BX // loop end
// R9 v2 #define v1 R8
// R10 v3 #define v2 R9
// R11 v4 #define v3 R10
// R12 tmp #define v4 R11
// R13 prime1v #define x R12
// R14 prime2v #define prime1 R13
// DI prime4v #define prime2 R14
#define prime4 DI
// round reads from and advances the buffer pointer in SI. #define round(acc, x) \
// It assumes that R13 has prime1v and R14 has prime2v. IMULQ prime2, x \
#define round(r) \ ADDQ x, acc \
MOVQ (SI), R12 \ ROLQ $31, acc \
ADDQ $8, SI \ IMULQ prime1, acc
IMULQ R14, R12 \
ADDQ R12, r \
ROLQ $31, r \
IMULQ R13, r
// mergeRound applies a merge round on the two registers acc and val. // round0 performs the operation x = round(0, x).
// It assumes that R13 has prime1v, R14 has prime2v, and DI has prime4v. #define round0(x) \
#define mergeRound(acc, val) \ IMULQ prime2, x \
IMULQ R14, val \ ROLQ $31, x \
ROLQ $31, val \ IMULQ prime1, x
IMULQ R13, val \
XORQ val, acc \ // mergeRound applies a merge round on the two registers acc and x.
IMULQ R13, acc \ // It assumes that prime1, prime2, and prime4 have been loaded.
ADDQ DI, acc #define mergeRound(acc, x) \
round0(x) \
XORQ x, acc \
IMULQ prime1, acc \
ADDQ prime4, acc
// blockLoop processes as many 32-byte blocks as possible,
// updating v1, v2, v3, and v4. It assumes that there is at least one block
// to process.
#define blockLoop() \
loop: \
MOVQ +0(p), x \
round(v1, x) \
MOVQ +8(p), x \
round(v2, x) \
MOVQ +16(p), x \
round(v3, x) \
MOVQ +24(p), x \
round(v4, x) \
ADDQ $32, p \
CMPQ p, end \
JLE loop
// func Sum64(b []byte) uint64 // func Sum64(b []byte) uint64
TEXT ·Sum64(SB), NOSPLIT, $0-32 TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32
// Load fixed primes. // Load fixed primes.
MOVQ ·prime1v(SB), R13 MOVQ ·primes+0(SB), prime1
MOVQ ·prime2v(SB), R14 MOVQ ·primes+8(SB), prime2
MOVQ ·prime4v(SB), DI MOVQ ·primes+24(SB), prime4
// Load slice. // Load slice.
MOVQ b_base+0(FP), SI MOVQ b_base+0(FP), p
MOVQ b_len+8(FP), DX MOVQ b_len+8(FP), n
LEAQ (SI)(DX*1), BX LEAQ (p)(n*1), end
// The first loop limit will be len(b)-32. // The first loop limit will be len(b)-32.
SUBQ $32, BX SUBQ $32, end
// Check whether we have at least one block. // Check whether we have at least one block.
CMPQ DX, $32 CMPQ n, $32
JLT noBlocks JLT noBlocks
// Set up initial state (v1, v2, v3, v4). // Set up initial state (v1, v2, v3, v4).
MOVQ R13, R8 MOVQ prime1, v1
ADDQ R14, R8 ADDQ prime2, v1
MOVQ R14, R9 MOVQ prime2, v2
XORQ R10, R10 XORQ v3, v3
XORQ R11, R11 XORQ v4, v4
SUBQ R13, R11 SUBQ prime1, v4
// Loop until SI > BX. blockLoop()
blockLoop:
round(R8)
round(R9)
round(R10)
round(R11)
CMPQ SI, BX MOVQ v1, h
JLE blockLoop ROLQ $1, h
MOVQ v2, x
ROLQ $7, x
ADDQ x, h
MOVQ v3, x
ROLQ $12, x
ADDQ x, h
MOVQ v4, x
ROLQ $18, x
ADDQ x, h
MOVQ R8, AX mergeRound(h, v1)
ROLQ $1, AX mergeRound(h, v2)
MOVQ R9, R12 mergeRound(h, v3)
ROLQ $7, R12 mergeRound(h, v4)
ADDQ R12, AX
MOVQ R10, R12
ROLQ $12, R12
ADDQ R12, AX
MOVQ R11, R12
ROLQ $18, R12
ADDQ R12, AX
mergeRound(AX, R8)
mergeRound(AX, R9)
mergeRound(AX, R10)
mergeRound(AX, R11)
JMP afterBlocks JMP afterBlocks
noBlocks: noBlocks:
MOVQ ·prime5v(SB), AX MOVQ ·primes+32(SB), h
afterBlocks: afterBlocks:
ADDQ DX, AX ADDQ n, h
// Right now BX has len(b)-32, and we want to loop until SI > len(b)-8. ADDQ $24, end
ADDQ $24, BX CMPQ p, end
JG try4
CMPQ SI, BX loop8:
JG fourByte MOVQ (p), x
ADDQ $8, p
round0(x)
XORQ x, h
ROLQ $27, h
IMULQ prime1, h
ADDQ prime4, h
wordLoop: CMPQ p, end
// Calculate k1. JLE loop8
MOVQ (SI), R8
ADDQ $8, SI
IMULQ R14, R8
ROLQ $31, R8
IMULQ R13, R8
XORQ R8, AX try4:
ROLQ $27, AX ADDQ $4, end
IMULQ R13, AX CMPQ p, end
ADDQ DI, AX JG try1
CMPQ SI, BX MOVL (p), x
JLE wordLoop ADDQ $4, p
IMULQ prime1, x
XORQ x, h
fourByte: ROLQ $23, h
ADDQ $4, BX IMULQ prime2, h
CMPQ SI, BX ADDQ ·primes+16(SB), h
JG singles
MOVL (SI), R8 try1:
ADDQ $4, SI ADDQ $4, end
IMULQ R13, R8 CMPQ p, end
XORQ R8, AX
ROLQ $23, AX
IMULQ R14, AX
ADDQ ·prime3v(SB), AX
singles:
ADDQ $4, BX
CMPQ SI, BX
JGE finalize JGE finalize
singlesLoop: loop1:
MOVBQZX (SI), R12 MOVBQZX (p), x
ADDQ $1, SI ADDQ $1, p
IMULQ ·prime5v(SB), R12 IMULQ ·primes+32(SB), x
XORQ R12, AX XORQ x, h
ROLQ $11, h
IMULQ prime1, h
ROLQ $11, AX CMPQ p, end
IMULQ R13, AX JL loop1
CMPQ SI, BX
JL singlesLoop
finalize: finalize:
MOVQ AX, R12 MOVQ h, x
SHRQ $33, R12 SHRQ $33, x
XORQ R12, AX XORQ x, h
IMULQ R14, AX IMULQ prime2, h
MOVQ AX, R12 MOVQ h, x
SHRQ $29, R12 SHRQ $29, x
XORQ R12, AX XORQ x, h
IMULQ ·prime3v(SB), AX IMULQ ·primes+16(SB), h
MOVQ AX, R12 MOVQ h, x
SHRQ $32, R12 SHRQ $32, x
XORQ R12, AX XORQ x, h
MOVQ AX, ret+24(FP) MOVQ h, ret+24(FP)
RET RET
// writeBlocks uses the same registers as above except that it uses AX to store
// the d pointer.
// func writeBlocks(d *Digest, b []byte) int // func writeBlocks(d *Digest, b []byte) int
TEXT ·writeBlocks(SB), NOSPLIT, $0-40 TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40
// Load fixed primes needed for round. // Load fixed primes needed for round.
MOVQ ·prime1v(SB), R13 MOVQ ·primes+0(SB), prime1
MOVQ ·prime2v(SB), R14 MOVQ ·primes+8(SB), prime2
// Load slice. // Load slice.
MOVQ b_base+8(FP), SI MOVQ b_base+8(FP), p
MOVQ b_len+16(FP), DX MOVQ b_len+16(FP), n
LEAQ (SI)(DX*1), BX LEAQ (p)(n*1), end
SUBQ $32, BX SUBQ $32, end
// Load vN from d. // Load vN from d.
MOVQ d+0(FP), AX MOVQ s+0(FP), d
MOVQ 0(AX), R8 // v1 MOVQ 0(d), v1
MOVQ 8(AX), R9 // v2 MOVQ 8(d), v2
MOVQ 16(AX), R10 // v3 MOVQ 16(d), v3
MOVQ 24(AX), R11 // v4 MOVQ 24(d), v4
// We don't need to check the loop condition here; this function is // We don't need to check the loop condition here; this function is
// always called with at least one block of data to process. // always called with at least one block of data to process.
blockLoop: blockLoop()
round(R8)
round(R9)
round(R10)
round(R11)
CMPQ SI, BX
JLE blockLoop
// Copy vN back to d. // Copy vN back to d.
MOVQ R8, 0(AX) MOVQ v1, 0(d)
MOVQ R9, 8(AX) MOVQ v2, 8(d)
MOVQ R10, 16(AX) MOVQ v3, 16(d)
MOVQ R11, 24(AX) MOVQ v4, 24(d)
// The number of bytes written is SI minus the old base pointer. // The number of bytes written is p minus the old base pointer.
SUBQ b_base+8(FP), SI SUBQ b_base+8(FP), p
MOVQ SI, ret+32(FP) MOVQ p, ret+32(FP)
RET RET

183
vendor/github.com/cespare/xxhash/v2/xxhash_arm64.s generated vendored Normal file
View file

@ -0,0 +1,183 @@
//go:build !appengine && gc && !purego
// +build !appengine
// +build gc
// +build !purego
#include "textflag.h"
// Registers:
#define digest R1
#define h R2 // return value
#define p R3 // input pointer
#define n R4 // input length
#define nblocks R5 // n / 32
#define prime1 R7
#define prime2 R8
#define prime3 R9
#define prime4 R10
#define prime5 R11
#define v1 R12
#define v2 R13
#define v3 R14
#define v4 R15
#define x1 R20
#define x2 R21
#define x3 R22
#define x4 R23
#define round(acc, x) \
MADD prime2, acc, x, acc \
ROR $64-31, acc \
MUL prime1, acc
// round0 performs the operation x = round(0, x).
#define round0(x) \
MUL prime2, x \
ROR $64-31, x \
MUL prime1, x
#define mergeRound(acc, x) \
round0(x) \
EOR x, acc \
MADD acc, prime4, prime1, acc
// blockLoop processes as many 32-byte blocks as possible,
// updating v1, v2, v3, and v4. It assumes that n >= 32.
#define blockLoop() \
LSR $5, n, nblocks \
PCALIGN $16 \
loop: \
LDP.P 16(p), (x1, x2) \
LDP.P 16(p), (x3, x4) \
round(v1, x1) \
round(v2, x2) \
round(v3, x3) \
round(v4, x4) \
SUB $1, nblocks \
CBNZ nblocks, loop
// func Sum64(b []byte) uint64
TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32
LDP b_base+0(FP), (p, n)
LDP ·primes+0(SB), (prime1, prime2)
LDP ·primes+16(SB), (prime3, prime4)
MOVD ·primes+32(SB), prime5
CMP $32, n
CSEL LT, prime5, ZR, h // if n < 32 { h = prime5 } else { h = 0 }
BLT afterLoop
ADD prime1, prime2, v1
MOVD prime2, v2
MOVD $0, v3
NEG prime1, v4
blockLoop()
ROR $64-1, v1, x1
ROR $64-7, v2, x2
ADD x1, x2
ROR $64-12, v3, x3
ROR $64-18, v4, x4
ADD x3, x4
ADD x2, x4, h
mergeRound(h, v1)
mergeRound(h, v2)
mergeRound(h, v3)
mergeRound(h, v4)
afterLoop:
ADD n, h
TBZ $4, n, try8
LDP.P 16(p), (x1, x2)
round0(x1)
// NOTE: here and below, sequencing the EOR after the ROR (using a
// rotated register) is worth a small but measurable speedup for small
// inputs.
ROR $64-27, h
EOR x1 @> 64-27, h, h
MADD h, prime4, prime1, h
round0(x2)
ROR $64-27, h
EOR x2 @> 64-27, h, h
MADD h, prime4, prime1, h
try8:
TBZ $3, n, try4
MOVD.P 8(p), x1
round0(x1)
ROR $64-27, h
EOR x1 @> 64-27, h, h
MADD h, prime4, prime1, h
try4:
TBZ $2, n, try2
MOVWU.P 4(p), x2
MUL prime1, x2
ROR $64-23, h
EOR x2 @> 64-23, h, h
MADD h, prime3, prime2, h
try2:
TBZ $1, n, try1
MOVHU.P 2(p), x3
AND $255, x3, x1
LSR $8, x3, x2
MUL prime5, x1
ROR $64-11, h
EOR x1 @> 64-11, h, h
MUL prime1, h
MUL prime5, x2
ROR $64-11, h
EOR x2 @> 64-11, h, h
MUL prime1, h
try1:
TBZ $0, n, finalize
MOVBU (p), x4
MUL prime5, x4
ROR $64-11, h
EOR x4 @> 64-11, h, h
MUL prime1, h
finalize:
EOR h >> 33, h
MUL prime2, h
EOR h >> 29, h
MUL prime3, h
EOR h >> 32, h
MOVD h, ret+24(FP)
RET
// func writeBlocks(d *Digest, b []byte) int
TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40
LDP ·primes+0(SB), (prime1, prime2)
// Load state. Assume v[1-4] are stored contiguously.
MOVD d+0(FP), digest
LDP 0(digest), (v1, v2)
LDP 16(digest), (v3, v4)
LDP b_base+8(FP), (p, n)
blockLoop()
// Store updated state.
STP (v1, v2), 0(digest)
STP (v3, v4), 16(digest)
BIC $31, n
MOVD n, ret+32(FP)
RET

View file

@ -1,3 +1,5 @@
//go:build (amd64 || arm64) && !appengine && gc && !purego
// +build amd64 arm64
// +build !appengine // +build !appengine
// +build gc // +build gc
// +build !purego // +build !purego

View file

@ -1,4 +1,5 @@
// +build !amd64 appengine !gc purego //go:build (!amd64 && !arm64) || appengine || !gc || purego
// +build !amd64,!arm64 appengine !gc purego
package xxhash package xxhash
@ -14,10 +15,10 @@ func Sum64(b []byte) uint64 {
var h uint64 var h uint64
if n >= 32 { if n >= 32 {
v1 := prime1v + prime2 v1 := primes[0] + prime2
v2 := prime2 v2 := prime2
v3 := uint64(0) v3 := uint64(0)
v4 := -prime1v v4 := -primes[0]
for len(b) >= 32 { for len(b) >= 32 {
v1 = round(v1, u64(b[0:8:len(b)])) v1 = round(v1, u64(b[0:8:len(b)]))
v2 = round(v2, u64(b[8:16:len(b)])) v2 = round(v2, u64(b[8:16:len(b)]))
@ -36,19 +37,18 @@ func Sum64(b []byte) uint64 {
h += uint64(n) h += uint64(n)
i, end := 0, len(b) for ; len(b) >= 8; b = b[8:] {
for ; i+8 <= end; i += 8 { k1 := round(0, u64(b[:8]))
k1 := round(0, u64(b[i:i+8:len(b)]))
h ^= k1 h ^= k1
h = rol27(h)*prime1 + prime4 h = rol27(h)*prime1 + prime4
} }
if i+4 <= end { if len(b) >= 4 {
h ^= uint64(u32(b[i:i+4:len(b)])) * prime1 h ^= uint64(u32(b[:4])) * prime1
h = rol23(h)*prime2 + prime3 h = rol23(h)*prime2 + prime3
i += 4 b = b[4:]
} }
for ; i < end; i++ { for ; len(b) > 0; b = b[1:] {
h ^= uint64(b[i]) * prime5 h ^= uint64(b[0]) * prime5
h = rol11(h) * prime1 h = rol11(h) * prime1
} }

View file

@ -1,3 +1,4 @@
//go:build appengine
// +build appengine // +build appengine
// This file contains the safe implementations of otherwise unsafe-using code. // This file contains the safe implementations of otherwise unsafe-using code.

View file

@ -1,3 +1,4 @@
//go:build !appengine
// +build !appengine // +build !appengine
// This file encapsulates usage of unsafe. // This file encapsulates usage of unsafe.
@ -11,7 +12,7 @@ import (
// In the future it's possible that compiler optimizations will make these // In the future it's possible that compiler optimizations will make these
// XxxString functions unnecessary by realizing that calls such as // XxxString functions unnecessary by realizing that calls such as
// Sum64([]byte(s)) don't need to copy s. See https://golang.org/issue/2205. // Sum64([]byte(s)) don't need to copy s. See https://go.dev/issue/2205.
// If that happens, even if we keep these functions they can be replaced with // If that happens, even if we keep these functions they can be replaced with
// the trivial safe code. // the trivial safe code.

View file

@ -1,12 +1,12 @@
sudo: false sudo: false
language: go language: go
go_import_path: github.com/dustin/go-humanize
go: go:
- 1.3.x - 1.13.x
- 1.5.x - 1.14.x
- 1.6.x - 1.15.x
- 1.7.x - 1.16.x
- 1.8.x - stable
- 1.9.x
- master - master
matrix: matrix:
allow_failures: allow_failures:
@ -15,7 +15,7 @@ matrix:
install: install:
- # Do nothing. This is needed to prevent default install action "go get -t -v ./..." from happening here (we want it to happen inside script step). - # Do nothing. This is needed to prevent default install action "go get -t -v ./..." from happening here (we want it to happen inside script step).
script: script:
- go get -t -v ./...
- diff -u <(echo -n) <(gofmt -d -s .) - diff -u <(echo -n) <(gofmt -d -s .)
- go tool vet . - go vet .
- go install -v -race ./...
- go test -v -race ./... - go test -v -race ./...

View file

@ -5,7 +5,7 @@ Just a few functions for helping humanize times and sizes.
`go get` it as `github.com/dustin/go-humanize`, import it as `go get` it as `github.com/dustin/go-humanize`, import it as
`"github.com/dustin/go-humanize"`, use it as `humanize`. `"github.com/dustin/go-humanize"`, use it as `humanize`.
See [godoc](https://godoc.org/github.com/dustin/go-humanize) for See [godoc](https://pkg.go.dev/github.com/dustin/go-humanize) for
complete documentation. complete documentation.
## Sizes ## Sizes

View file

@ -28,6 +28,10 @@ var (
BigZiByte = (&big.Int{}).Mul(BigEiByte, bigIECExp) BigZiByte = (&big.Int{}).Mul(BigEiByte, bigIECExp)
// BigYiByte is 1,024 z bytes in bit.Ints // BigYiByte is 1,024 z bytes in bit.Ints
BigYiByte = (&big.Int{}).Mul(BigZiByte, bigIECExp) BigYiByte = (&big.Int{}).Mul(BigZiByte, bigIECExp)
// BigRiByte is 1,024 y bytes in bit.Ints
BigRiByte = (&big.Int{}).Mul(BigYiByte, bigIECExp)
// BigQiByte is 1,024 r bytes in bit.Ints
BigQiByte = (&big.Int{}).Mul(BigRiByte, bigIECExp)
) )
var ( var (
@ -51,6 +55,10 @@ var (
BigZByte = (&big.Int{}).Mul(BigEByte, bigSIExp) BigZByte = (&big.Int{}).Mul(BigEByte, bigSIExp)
// BigYByte is 1,000 SI z bytes in big.Ints // BigYByte is 1,000 SI z bytes in big.Ints
BigYByte = (&big.Int{}).Mul(BigZByte, bigSIExp) BigYByte = (&big.Int{}).Mul(BigZByte, bigSIExp)
// BigRByte is 1,000 SI y bytes in big.Ints
BigRByte = (&big.Int{}).Mul(BigYByte, bigSIExp)
// BigQByte is 1,000 SI r bytes in big.Ints
BigQByte = (&big.Int{}).Mul(BigRByte, bigSIExp)
) )
var bigBytesSizeTable = map[string]*big.Int{ var bigBytesSizeTable = map[string]*big.Int{
@ -71,6 +79,10 @@ var bigBytesSizeTable = map[string]*big.Int{
"zb": BigZByte, "zb": BigZByte,
"yib": BigYiByte, "yib": BigYiByte,
"yb": BigYByte, "yb": BigYByte,
"rib": BigRiByte,
"rb": BigRByte,
"qib": BigQiByte,
"qb": BigQByte,
// Without suffix // Without suffix
"": BigByte, "": BigByte,
"ki": BigKiByte, "ki": BigKiByte,
@ -89,6 +101,10 @@ var bigBytesSizeTable = map[string]*big.Int{
"zi": BigZiByte, "zi": BigZiByte,
"y": BigYByte, "y": BigYByte,
"yi": BigYiByte, "yi": BigYiByte,
"r": BigRByte,
"ri": BigRiByte,
"q": BigQByte,
"qi": BigQiByte,
} }
var ten = big.NewInt(10) var ten = big.NewInt(10)
@ -115,7 +131,7 @@ func humanateBigBytes(s, base *big.Int, sizes []string) string {
// //
// BigBytes(82854982) -> 83 MB // BigBytes(82854982) -> 83 MB
func BigBytes(s *big.Int) string { func BigBytes(s *big.Int) string {
sizes := []string{"B", "kB", "MB", "GB", "TB", "PB", "EB", "ZB", "YB"} sizes := []string{"B", "kB", "MB", "GB", "TB", "PB", "EB", "ZB", "YB", "RB", "QB"}
return humanateBigBytes(s, bigSIExp, sizes) return humanateBigBytes(s, bigSIExp, sizes)
} }
@ -125,7 +141,7 @@ func BigBytes(s *big.Int) string {
// //
// BigIBytes(82854982) -> 79 MiB // BigIBytes(82854982) -> 79 MiB
func BigIBytes(s *big.Int) string { func BigIBytes(s *big.Int) string {
sizes := []string{"B", "KiB", "MiB", "GiB", "TiB", "PiB", "EiB", "ZiB", "YiB"} sizes := []string{"B", "KiB", "MiB", "GiB", "TiB", "PiB", "EiB", "ZiB", "YiB", "RiB", "QiB"}
return humanateBigBytes(s, bigIECExp, sizes) return humanateBigBytes(s, bigIECExp, sizes)
} }

View file

@ -1,3 +1,4 @@
//go:build go1.6
// +build go1.6 // +build go1.6
package humanize package humanize

View file

@ -6,6 +6,9 @@ import (
) )
func stripTrailingZeros(s string) string { func stripTrailingZeros(s string) string {
if !strings.ContainsRune(s, '.') {
return s
}
offset := len(s) - 1 offset := len(s) - 1
for offset > 0 { for offset > 0 {
if s[offset] == '.' { if s[offset] == '.' {

View file

@ -73,7 +73,7 @@ func FormatFloat(format string, n float64) string {
if n > math.MaxFloat64 { if n > math.MaxFloat64 {
return "Infinity" return "Infinity"
} }
if n < -math.MaxFloat64 { if n < (0.0 - math.MaxFloat64) {
return "-Infinity" return "-Infinity"
} }

View file

@ -8,6 +8,8 @@ import (
) )
var siPrefixTable = map[float64]string{ var siPrefixTable = map[float64]string{
-30: "q", // quecto
-27: "r", // ronto
-24: "y", // yocto -24: "y", // yocto
-21: "z", // zepto -21: "z", // zepto
-18: "a", // atto -18: "a", // atto
@ -25,6 +27,8 @@ var siPrefixTable = map[float64]string{
18: "E", // exa 18: "E", // exa
21: "Z", // zetta 21: "Z", // zetta
24: "Y", // yotta 24: "Y", // yotta
27: "R", // ronna
30: "Q", // quetta
} }
var revSIPrefixTable = revfmap(siPrefixTable) var revSIPrefixTable = revfmap(siPrefixTable)

View file

@ -54,9 +54,9 @@ import "github.com/golang-jwt/jwt/v4"
See [the project documentation](https://pkg.go.dev/github.com/golang-jwt/jwt/v4) for examples of usage: See [the project documentation](https://pkg.go.dev/github.com/golang-jwt/jwt/v4) for examples of usage:
* [Simple example of parsing and validating a token](https://pkg.go.dev/github.com/golang-jwt/jwt#example-Parse-Hmac) * [Simple example of parsing and validating a token](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#example-Parse-Hmac)
* [Simple example of building and signing a token](https://pkg.go.dev/github.com/golang-jwt/jwt#example-New-Hmac) * [Simple example of building and signing a token](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#example-New-Hmac)
* [Directory of Examples](https://pkg.go.dev/github.com/golang-jwt/jwt#pkg-examples) * [Directory of Examples](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#pkg-examples)
## Extensions ## Extensions
@ -96,7 +96,7 @@ A token is simply a JSON object that is signed by its author. this tells you exa
* The author of the token was in the possession of the signing secret * The author of the token was in the possession of the signing secret
* The data has not been modified since it was signed * The data has not been modified since it was signed
It's important to know that JWT does not provide encryption, which means anyone who has access to the token can read its contents. If you need to protect (encrypt) the data, there is a companion spec, `JWE`, that provides this functionality. JWE is currently outside the scope of this library. It's important to know that JWT does not provide encryption, which means anyone who has access to the token can read its contents. If you need to protect (encrypt) the data, there is a companion spec, `JWE`, that provides this functionality. The companion project https://github.com/golang-jwt/jwe aims at a (very) experimental implementation of the JWE standard.
### Choosing a Signing Method ### Choosing a Signing Method
@ -110,10 +110,10 @@ Asymmetric signing methods, such as RSA, use different keys for signing and veri
Each signing method expects a different object type for its signing keys. See the package documentation for details. Here are the most common ones: Each signing method expects a different object type for its signing keys. See the package documentation for details. Here are the most common ones:
* The [HMAC signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodHMAC) (`HS256`,`HS384`,`HS512`) expect `[]byte` values for signing and validation * The [HMAC signing method](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#SigningMethodHMAC) (`HS256`,`HS384`,`HS512`) expect `[]byte` values for signing and validation
* The [RSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodRSA) (`RS256`,`RS384`,`RS512`) expect `*rsa.PrivateKey` for signing and `*rsa.PublicKey` for validation * The [RSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#SigningMethodRSA) (`RS256`,`RS384`,`RS512`) expect `*rsa.PrivateKey` for signing and `*rsa.PublicKey` for validation
* The [ECDSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodECDSA) (`ES256`,`ES384`,`ES512`) expect `*ecdsa.PrivateKey` for signing and `*ecdsa.PublicKey` for validation * The [ECDSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#SigningMethodECDSA) (`ES256`,`ES384`,`ES512`) expect `*ecdsa.PrivateKey` for signing and `*ecdsa.PublicKey` for validation
* The [EdDSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodEd25519) (`Ed25519`) expect `ed25519.PrivateKey` for signing and `ed25519.PublicKey` for validation * The [EdDSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt/v4#SigningMethodEd25519) (`Ed25519`) expect `ed25519.PrivateKey` for signing and `ed25519.PublicKey` for validation
### JWT and OAuth ### JWT and OAuth
@ -131,7 +131,7 @@ This library uses descriptive error messages whenever possible. If you are not g
## More ## More
Documentation can be found [on pkg.go.dev](https://pkg.go.dev/github.com/golang-jwt/jwt). Documentation can be found [on pkg.go.dev](https://pkg.go.dev/github.com/golang-jwt/jwt/v4).
The command line utility included in this project (cmd/jwt) provides a straightforward example of token creation and parsing as well as a useful tool for debugging your own integration. You'll also find several implementation examples in the documentation. The command line utility included in this project (cmd/jwt) provides a straightforward example of token creation and parsing as well as a useful tool for debugging your own integration. You'll also find several implementation examples in the documentation.

View file

@ -265,9 +265,5 @@ func verifyIss(iss string, cmp string, required bool) bool {
if iss == "" { if iss == "" {
return !required return !required
} }
if subtle.ConstantTimeCompare([]byte(iss), []byte(cmp)) != 0 { return subtle.ConstantTimeCompare([]byte(iss), []byte(cmp)) != 0
return true
} else {
return false
}
} }

View file

@ -42,6 +42,13 @@ func (p *Parser) Parse(tokenString string, keyFunc Keyfunc) (*Token, error) {
return p.ParseWithClaims(tokenString, MapClaims{}, keyFunc) return p.ParseWithClaims(tokenString, MapClaims{}, keyFunc)
} }
// ParseWithClaims parses, validates, and verifies like Parse, but supplies a default object implementing the Claims
// interface. This provides default values which can be overridden and allows a caller to use their own type, rather
// than the default MapClaims implementation of Claims.
//
// Note: If you provide a custom claim implementation that embeds one of the standard claims (such as RegisteredClaims),
// make sure that a) you either embed a non-pointer version of the claims or b) if you are using a pointer, allocate the
// proper memory for it before passing in the overall claims, otherwise you might run into a panic.
func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc) (*Token, error) { func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc) (*Token, error) {
token, parts, err := p.ParseUnverified(tokenString, claims) token, parts, err := p.ParseUnverified(tokenString, claims)
if err != nil { if err != nil {

View file

@ -99,6 +99,11 @@ func Parse(tokenString string, keyFunc Keyfunc, options ...ParserOption) (*Token
return NewParser(options...).Parse(tokenString, keyFunc) return NewParser(options...).Parse(tokenString, keyFunc)
} }
// ParseWithClaims is a shortcut for NewParser().ParseWithClaims().
//
// Note: If you provide a custom claim implementation that embeds one of the standard claims (such as RegisteredClaims),
// make sure that a) you either embed a non-pointer version of the claims or b) if you are using a pointer, allocate the
// proper memory for it before passing in the overall claims, otherwise you might run into a panic.
func ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc, options ...ParserOption) (*Token, error) { func ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc, options ...ParserOption) (*Token, error) {
return NewParser(options...).ParseWithClaims(tokenString, claims, keyFunc) return NewParser(options...).ParseWithClaims(tokenString, claims, keyFunc)
} }

View file

@ -325,35 +325,35 @@ The content compressed in this mode is fully compatible with the standard decode
Snappy vs S2 **compression** speed on 16 core (32 thread) computer, using all threads and a single thread (1 CPU): Snappy vs S2 **compression** speed on 16 core (32 thread) computer, using all threads and a single thread (1 CPU):
| File | S2 speed | S2 Throughput | S2 % smaller | S2 "better" | "better" throughput | "better" % smaller | | File | S2 Speed | S2 Throughput | S2 % smaller | S2 "better" | "better" throughput | "better" % smaller |
|-----------------------------------------------------------------------------------------------------|----------|---------------|--------------|-------------|---------------------|--------------------| |---------------------------------------------------------------------------------------------------------|----------|---------------|--------------|-------------|---------------------|--------------------|
| [rawstudio-mint14.tar](https://files.klauspost.com/compress/rawstudio-mint14.7z) | 12.70x | 10556 MB/s | 7.35% | 4.15x | 3455 MB/s | 12.79% | | [rawstudio-mint14.tar](https://files.klauspost.com/compress/rawstudio-mint14.7z) | 16.33x | 10556 MB/s | 8.0% | 6.04x | 5252 MB/s | 14.7% |
| (1 CPU) | 1.14x | 948 MB/s | - | 0.42x | 349 MB/s | - | | (1 CPU) | 1.08x | 940 MB/s | - | 0.46x | 400 MB/s | - |
| [github-june-2days-2019.json](https://files.klauspost.com/compress/github-june-2days-2019.json.zst) | 17.13x | 14484 MB/s | 31.60% | 10.09x | 8533 MB/s | 37.71% | | [github-june-2days-2019.json](https://files.klauspost.com/compress/github-june-2days-2019.json.zst) | 16.51x | 15224 MB/s | 31.70% | 9.47x | 8734 MB/s | 37.71% |
| (1 CPU) | 1.33x | 1127 MB/s | - | 0.70x | 589 MB/s | - | | (1 CPU) | 1.26x | 1157 MB/s | - | 0.60x | 556 MB/s | - |
| [github-ranks-backup.bin](https://files.klauspost.com/compress/github-ranks-backup.bin.zst) | 15.14x | 12000 MB/s | -5.79% | 6.59x | 5223 MB/s | 5.80% | | [github-ranks-backup.bin](https://files.klauspost.com/compress/github-ranks-backup.bin.zst) | 15.14x | 12598 MB/s | -5.76% | 6.23x | 5675 MB/s | 3.62% |
| (1 CPU) | 1.11x | 877 MB/s | - | 0.47x | 370 MB/s | - | | (1 CPU) | 1.02x | 932 MB/s | - | 0.47x | 432 MB/s | - |
| [consensus.db.10gb](https://files.klauspost.com/compress/consensus.db.10gb.zst) | 14.62x | 12116 MB/s | 15.90% | 5.35x | 4430 MB/s | 16.08% | | [consensus.db.10gb](https://files.klauspost.com/compress/consensus.db.10gb.zst) | 11.21x | 12116 MB/s | 15.95% | 3.24x | 3500 MB/s | 18.00% |
| (1 CPU) | 1.38x | 1146 MB/s | - | 0.38x | 312 MB/s | - | | (1 CPU) | 1.05x | 1135 MB/s | - | 0.27x | 292 MB/s | - |
| [adresser.json](https://files.klauspost.com/compress/adresser.json.zst) | 8.83x | 17579 MB/s | 43.86% | 6.54x | 13011 MB/s | 47.23% | | [apache.log](https://files.klauspost.com/compress/apache.log.zst) | 8.55x | 16673 MB/s | 20.54% | 5.85x | 11420 MB/s | 24.97% |
| (1 CPU) | 1.14x | 2259 MB/s | - | 0.74x | 1475 MB/s | - | | (1 CPU) | 1.91x | 1771 MB/s | - | 0.53x | 1041 MB/s | - |
| [gob-stream](https://files.klauspost.com/compress/gob-stream.7z) | 16.72x | 14019 MB/s | 24.02% | 10.11x | 8477 MB/s | 30.48% | | [gob-stream](https://files.klauspost.com/compress/gob-stream.7z) | 15.76x | 14357 MB/s | 24.01% | 8.67x | 7891 MB/s | 33.68% |
| (1 CPU) | 1.24x | 1043 MB/s | - | 0.70x | 586 MB/s | - | | (1 CPU) | 1.17x | 1064 MB/s | - | 0.65x | 595 MB/s | - |
| [10gb.tar](http://mattmahoney.net/dc/10gb.html) | 13.33x | 9254 MB/s | 1.84% | 6.75x | 4686 MB/s | 6.72% | | [10gb.tar](http://mattmahoney.net/dc/10gb.html) | 13.33x | 9835 MB/s | 2.34% | 6.85x | 4863 MB/s | 9.96% |
| (1 CPU) | 0.97x | 672 MB/s | - | 0.53x | 366 MB/s | - | | (1 CPU) | 0.97x | 689 MB/s | - | 0.55x | 387 MB/s | - |
| sharnd.out.2gb | 2.11x | 12639 MB/s | 0.01% | 1.98x | 11833 MB/s | 0.01% | | sharnd.out.2gb | 9.11x | 13213 MB/s | 0.01% | 1.49x | 9184 MB/s | 0.01% |
| (1 CPU) | 0.93x | 5594 MB/s | - | 1.34x | 8030 MB/s | - | | (1 CPU) | 0.88x | 5418 MB/s | - | 0.77x | 5417 MB/s | - |
| [enwik9](http://mattmahoney.net/dc/textdata.html) | 19.34x | 8220 MB/s | 3.98% | 7.87x | 3345 MB/s | 15.82% | | [sofia-air-quality-dataset csv](https://files.klauspost.com/compress/sofia-air-quality-dataset.tar.zst) | 22.00x | 11477 MB/s | 18.73% | 11.15x | 5817 MB/s | 27.88% |
| (1 CPU) | 1.06x | 452 MB/s | - | 0.50x | 213 MB/s | - | | (1 CPU) | 1.23x | 642 MB/s | - | 0.71x | 642 MB/s | - |
| [silesia.tar](http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip) | 10.48x | 6124 MB/s | 5.67% | 3.76x | 2197 MB/s | 12.60% | | [silesia.tar](http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip) | 11.23x | 6520 MB/s | 5.9% | 5.35x | 3109 MB/s | 15.88% |
| (1 CPU) | 0.97x | 568 MB/s | - | 0.46x | 271 MB/s | - | | (1 CPU) | 1.05x | 607 MB/s | - | 0.52x | 304 MB/s | - |
| [enwik10](https://encode.su/threads/3315-enwik10-benchmark-results) | 21.07x | 9020 MB/s | 6.36% | 6.91x | 2959 MB/s | 16.95% | | [enwik9](https://files.klauspost.com/compress/enwik9.zst) | 19.28x | 8440 MB/s | 4.04% | 9.31x | 4076 MB/s | 18.04% |
| (1 CPU) | 1.07x | 460 MB/s | - | 0.51x | 220 MB/s | - | | (1 CPU) | 1.12x | 488 MB/s | - | 0.57x | 250 MB/s | - |
### Legend ### Legend
* `S2 speed`: Speed of S2 compared to Snappy, using 16 cores and 1 core. * `S2 Speed`: Speed of S2 compared to Snappy, using 16 cores and 1 core.
* `S2 throughput`: Throughput of S2 in MB/s. * `S2 Throughput`: Throughput of S2 in MB/s.
* `S2 % smaller`: How many percent of the Snappy output size is S2 better. * `S2 % smaller`: How many percent of the Snappy output size is S2 better.
* `S2 "better"`: Speed when enabling "better" compression mode in S2 compared to Snappy. * `S2 "better"`: Speed when enabling "better" compression mode in S2 compared to Snappy.
* `"better" throughput`: Speed when enabling "better" compression mode in S2 compared to Snappy. * `"better" throughput`: Speed when enabling "better" compression mode in S2 compared to Snappy.
@ -361,7 +361,7 @@ Snappy vs S2 **compression** speed on 16 core (32 thread) computer, using all th
There is a good speedup across the board when using a single thread and a significant speedup when using multiple threads. There is a good speedup across the board when using a single thread and a significant speedup when using multiple threads.
Machine generated data gets by far the biggest compression boost, with size being being reduced by up to 45% of Snappy size. Machine generated data gets by far the biggest compression boost, with size being reduced by up to 35% of Snappy size.
The "better" compression mode sees a good improvement in all cases, but usually at a performance cost. The "better" compression mode sees a good improvement in all cases, but usually at a performance cost.
@ -404,7 +404,7 @@ The "better" compression mode will actively look for shorter matches, which is w
Without assembly decompression is also very fast; single goroutine decompression speed. No assembly: Without assembly decompression is also very fast; single goroutine decompression speed. No assembly:
| File | S2 Throughput | S2 throughput | | File | S2 Throughput | S2 throughput |
|--------------------------------|--------------|---------------| |--------------------------------|---------------|---------------|
| consensus.db.10gb.s2 | 1.84x | 2289.8 MB/s | | consensus.db.10gb.s2 | 1.84x | 2289.8 MB/s |
| 10gb.tar.s2 | 1.30x | 867.07 MB/s | | 10gb.tar.s2 | 1.30x | 867.07 MB/s |
| rawstudio-mint14.tar.s2 | 1.66x | 1329.65 MB/s | | rawstudio-mint14.tar.s2 | 1.66x | 1329.65 MB/s |
@ -451,13 +451,13 @@ For this we use [`webdevdata.org-2015-01-07-subset`](https://files.klauspost.com
53927 files, total input size: 4,014,735,833 bytes. Single goroutine used. 53927 files, total input size: 4,014,735,833 bytes. Single goroutine used.
| * | Input | Output | Reduction | MB/s | | * | Input | Output | Reduction | MB/s |
|-------------------|------------|------------|-----------|--------| |-------------------|------------|------------|------------|------------|
| S2 | 4014735833 | 1059723369 | 73.60% | **934.34** | | S2 | 4014735833 | 1059723369 | 73.60% | **936.73** |
| S2 Better | 4014735833 | 969670507 | 75.85% | 532.70 | | S2 Better | 4014735833 | 961580539 | 76.05% | 451.10 |
| S2 Best | 4014735833 | 906625668 | **77.85%** | 46.84 | | S2 Best | 4014735833 | 899182886 | **77.60%** | 46.84 |
| Snappy | 4014735833 | 1128706759 | 71.89% | 762.59 | | Snappy | 4014735833 | 1128706759 | 71.89% | 790.15 |
| S2, Snappy Output | 4014735833 | 1093821420 | 72.75% | 908.60 | | S2, Snappy Output | 4014735833 | 1093823291 | 72.75% | 936.60 |
| LZ4 | 4014735833 | 1079259294 | 73.12% | 526.94 | | LZ4 | 4014735833 | 1063768713 | 73.50% | 452.02 |
S2 delivers both the best single threaded throughput with regular mode and the best compression rate with "best". S2 delivers both the best single threaded throughput with regular mode and the best compression rate with "best".
"Better" mode provides the same compression speed as LZ4 with better compression ratio. "Better" mode provides the same compression speed as LZ4 with better compression ratio.
@ -489,43 +489,24 @@ AMD64 assembly is use for both S2 and Snappy.
| Absolute Perf | Snappy size | S2 Size | Snappy Speed | S2 Speed | Snappy dec | S2 dec | | Absolute Perf | Snappy size | S2 Size | Snappy Speed | S2 Speed | Snappy dec | S2 dec |
|-----------------------|-------------|---------|--------------|-------------|-------------|-------------| |-----------------------|-------------|---------|--------------|-------------|-------------|-------------|
| html | 22843 | 21111 | 16246 MB/s | 17438 MB/s | 40972 MB/s | 49263 MB/s | | html | 22843 | 20868 | 16246 MB/s | 18617 MB/s | 40972 MB/s | 49263 MB/s |
| urls.10K | 335492 | 287326 | 7943 MB/s | 9693 MB/s | 22523 MB/s | 26484 MB/s | | urls.10K | 335492 | 286541 | 7943 MB/s | 10201 MB/s | 22523 MB/s | 26484 MB/s |
| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 273889 MB/s | 718321 MB/s | 827552 MB/s | | fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 303228 MB/s | 718321 MB/s | 827552 MB/s |
| fireworks.jpeg (200B) | 146 | 155 | 8869 MB/s | 17773 MB/s | 33691 MB/s | 52421 MB/s | | fireworks.jpeg (200B) | 146 | 155 | 8869 MB/s | 20180 MB/s | 33691 MB/s | 52421 MB/s |
| paper-100k.pdf | 85304 | 84459 | 167546 MB/s | 101263 MB/s | 326905 MB/s | 291944 MB/s | | paper-100k.pdf | 85304 | 84202 | 167546 MB/s | 112988 MB/s | 326905 MB/s | 291944 MB/s |
| html_x_4 | 92234 | 21113 | 15194 MB/s | 50670 MB/s | 30843 MB/s | 32217 MB/s | | html_x_4 | 92234 | 20870 | 15194 MB/s | 54457 MB/s | 30843 MB/s | 32217 MB/s |
| alice29.txt | 88034 | 85975 | 5936 MB/s | 6139 MB/s | 12882 MB/s | 20044 MB/s | | alice29.txt | 88034 | 85934 | 5936 MB/s | 6540 MB/s | 12882 MB/s | 20044 MB/s |
| asyoulik.txt | 77503 | 79650 | 5517 MB/s | 6366 MB/s | 12735 MB/s | 22806 MB/s | | asyoulik.txt | 77503 | 79575 | 5517 MB/s | 6657 MB/s | 12735 MB/s | 22806 MB/s |
| lcet10.txt | 234661 | 220670 | 6235 MB/s | 6067 MB/s | 14519 MB/s | 18697 MB/s | | lcet10.txt | 234661 | 220383 | 6235 MB/s | 6303 MB/s | 14519 MB/s | 18697 MB/s |
| plrabn12.txt | 319267 | 317985 | 5159 MB/s | 5726 MB/s | 11923 MB/s | 19901 MB/s | | plrabn12.txt | 319267 | 318196 | 5159 MB/s | 6074 MB/s | 11923 MB/s | 19901 MB/s |
| geo.protodata | 23335 | 18690 | 21220 MB/s | 26529 MB/s | 56271 MB/s | 62540 MB/s | | geo.protodata | 23335 | 18606 | 21220 MB/s | 25432 MB/s | 56271 MB/s | 62540 MB/s |
| kppkn.gtb | 69526 | 65312 | 9732 MB/s | 8559 MB/s | 18491 MB/s | 18969 MB/s | | kppkn.gtb | 69526 | 65019 | 9732 MB/s | 8905 MB/s | 18491 MB/s | 18969 MB/s |
| alice29.txt (128B) | 80 | 82 | 6691 MB/s | 15489 MB/s | 31883 MB/s | 38874 MB/s | | alice29.txt (128B) | 80 | 82 | 6691 MB/s | 17179 MB/s | 31883 MB/s | 38874 MB/s |
| alice29.txt (1000B) | 774 | 774 | 12204 MB/s | 13000 MB/s | 48056 MB/s | 52341 MB/s | | alice29.txt (1000B) | 774 | 774 | 12204 MB/s | 13273 MB/s | 48056 MB/s | 52341 MB/s |
| alice29.txt (10000B) | 6648 | 6933 | 10044 MB/s | 12806 MB/s | 32378 MB/s | 46322 MB/s | | alice29.txt (10000B) | 6648 | 6933 | 10044 MB/s | 12824 MB/s | 32378 MB/s | 46322 MB/s |
| alice29.txt (20000B) | 12686 | 13574 | 7733 MB/s | 11210 MB/s | 30566 MB/s | 58969 MB/s | | alice29.txt (20000B) | 12686 | 13516 | 7733 MB/s | 12160 MB/s | 30566 MB/s | 58969 MB/s |
| Relative Perf | Snappy size | S2 size improved | S2 Speed | S2 Dec Speed |
|-----------------------|-------------|------------------|----------|--------------|
| html | 22.31% | 7.58% | 1.07x | 1.20x |
| urls.10K | 47.78% | 14.36% | 1.22x | 1.18x |
| fireworks.jpeg | 99.95% | -0.05% | 0.78x | 1.15x |
| fireworks.jpeg (200B) | 73.00% | -6.16% | 2.00x | 1.56x |
| paper-100k.pdf | 83.30% | 0.99% | 0.60x | 0.89x |
| html_x_4 | 22.52% | 77.11% | 3.33x | 1.04x |
| alice29.txt | 57.88% | 2.34% | 1.03x | 1.56x |
| asyoulik.txt | 61.91% | -2.77% | 1.15x | 1.79x |
| lcet10.txt | 54.99% | 5.96% | 0.97x | 1.29x |
| plrabn12.txt | 66.26% | 0.40% | 1.11x | 1.67x |
| geo.protodata | 19.68% | 19.91% | 1.25x | 1.11x |
| kppkn.gtb | 37.72% | 6.06% | 0.88x | 1.03x |
| alice29.txt (128B) | 62.50% | -2.50% | 2.31x | 1.22x |
| alice29.txt (1000B) | 77.40% | 0.00% | 1.07x | 1.09x |
| alice29.txt (10000B) | 66.48% | -4.29% | 1.27x | 1.43x |
| alice29.txt (20000B) | 63.43% | -7.00% | 1.45x | 1.93x |
Speed is generally at or above Snappy. Small blocks gets a significant speedup, although at the expense of size. Speed is generally at or above Snappy. Small blocks gets a significant speedup, although at the expense of size.
Decompression speed is better than Snappy, except in one case. Decompression speed is better than Snappy, except in one case.
@ -543,43 +524,24 @@ So individual benchmarks should only be seen as a guideline and the overall pict
| Absolute Perf | Snappy size | Better Size | Snappy Speed | Better Speed | Snappy dec | Better dec | | Absolute Perf | Snappy size | Better Size | Snappy Speed | Better Speed | Snappy dec | Better dec |
|-----------------------|-------------|-------------|--------------|--------------|-------------|-------------| |-----------------------|-------------|-------------|--------------|--------------|-------------|-------------|
| html | 22843 | 19833 | 16246 MB/s | 7731 MB/s | 40972 MB/s | 40292 MB/s | | html | 22843 | 18972 | 16246 MB/s | 8621 MB/s | 40972 MB/s | 40292 MB/s |
| urls.10K | 335492 | 253529 | 7943 MB/s | 3980 MB/s | 22523 MB/s | 20981 MB/s | | urls.10K | 335492 | 248079 | 7943 MB/s | 5104 MB/s | 22523 MB/s | 20981 MB/s |
| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 9760 MB/s | 718321 MB/s | 823698 MB/s | | fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 84429 MB/s | 718321 MB/s | 823698 MB/s |
| fireworks.jpeg (200B) | 146 | 142 | 8869 MB/s | 594 MB/s | 33691 MB/s | 30101 MB/s | | fireworks.jpeg (200B) | 146 | 149 | 8869 MB/s | 7125 MB/s | 33691 MB/s | 30101 MB/s |
| paper-100k.pdf | 85304 | 82915 | 167546 MB/s | 7470 MB/s | 326905 MB/s | 198869 MB/s | | paper-100k.pdf | 85304 | 82887 | 167546 MB/s | 11087 MB/s | 326905 MB/s | 198869 MB/s |
| html_x_4 | 92234 | 19841 | 15194 MB/s | 23403 MB/s | 30843 MB/s | 30937 MB/s | | html_x_4 | 92234 | 18982 | 15194 MB/s | 29316 MB/s | 30843 MB/s | 30937 MB/s |
| alice29.txt | 88034 | 73218 | 5936 MB/s | 2945 MB/s | 12882 MB/s | 16611 MB/s | | alice29.txt | 88034 | 71611 | 5936 MB/s | 3709 MB/s | 12882 MB/s | 16611 MB/s |
| asyoulik.txt | 77503 | 66844 | 5517 MB/s | 2739 MB/s | 12735 MB/s | 14975 MB/s | | asyoulik.txt | 77503 | 65941 | 5517 MB/s | 3380 MB/s | 12735 MB/s | 14975 MB/s |
| lcet10.txt | 234661 | 190589 | 6235 MB/s | 3099 MB/s | 14519 MB/s | 16634 MB/s | | lcet10.txt | 234661 | 184939 | 6235 MB/s | 3537 MB/s | 14519 MB/s | 16634 MB/s |
| plrabn12.txt | 319267 | 270828 | 5159 MB/s | 2600 MB/s | 11923 MB/s | 13382 MB/s | | plrabn12.txt | 319267 | 264990 | 5159 MB/s | 2960 MB/s | 11923 MB/s | 13382 MB/s |
| geo.protodata | 23335 | 18278 | 21220 MB/s | 11208 MB/s | 56271 MB/s | 57961 MB/s | | geo.protodata | 23335 | 17689 | 21220 MB/s | 10859 MB/s | 56271 MB/s | 57961 MB/s |
| kppkn.gtb | 69526 | 61851 | 9732 MB/s | 4556 MB/s | 18491 MB/s | 16524 MB/s | | kppkn.gtb | 69526 | 55398 | 9732 MB/s | 5206 MB/s | 18491 MB/s | 16524 MB/s |
| alice29.txt (128B) | 80 | 81 | 6691 MB/s | 529 MB/s | 31883 MB/s | 34225 MB/s | | alice29.txt (128B) | 80 | 78 | 6691 MB/s | 7422 MB/s | 31883 MB/s | 34225 MB/s |
| alice29.txt (1000B) | 774 | 748 | 12204 MB/s | 1943 MB/s | 48056 MB/s | 42068 MB/s | | alice29.txt (1000B) | 774 | 746 | 12204 MB/s | 5734 MB/s | 48056 MB/s | 42068 MB/s |
| alice29.txt (10000B) | 6648 | 6234 | 10044 MB/s | 2949 MB/s | 32378 MB/s | 28813 MB/s | | alice29.txt (10000B) | 6648 | 6218 | 10044 MB/s | 6055 MB/s | 32378 MB/s | 28813 MB/s |
| alice29.txt (20000B) | 12686 | 11584 | 7733 MB/s | 2822 MB/s | 30566 MB/s | 27315 MB/s | | alice29.txt (20000B) | 12686 | 11492 | 7733 MB/s | 3143 MB/s | 30566 MB/s | 27315 MB/s |
| Relative Perf | Snappy size | Better size | Better Speed | Better dec |
|-----------------------|-------------|-------------|--------------|------------|
| html | 22.31% | 13.18% | 0.48x | 0.98x |
| urls.10K | 47.78% | 24.43% | 0.50x | 0.93x |
| fireworks.jpeg | 99.95% | -0.05% | 0.03x | 1.15x |
| fireworks.jpeg (200B) | 73.00% | 2.74% | 0.07x | 0.89x |
| paper-100k.pdf | 83.30% | 2.80% | 0.07x | 0.61x |
| html_x_4 | 22.52% | 78.49% | 0.04x | 1.00x |
| alice29.txt | 57.88% | 16.83% | 1.54x | 1.29x |
| asyoulik.txt | 61.91% | 13.75% | 0.50x | 1.18x |
| lcet10.txt | 54.99% | 18.78% | 0.50x | 1.15x |
| plrabn12.txt | 66.26% | 15.17% | 0.50x | 1.12x |
| geo.protodata | 19.68% | 21.67% | 0.50x | 1.03x |
| kppkn.gtb | 37.72% | 11.04% | 0.53x | 0.89x |
| alice29.txt (128B) | 62.50% | -1.25% | 0.47x | 1.07x |
| alice29.txt (1000B) | 77.40% | 3.36% | 0.08x | 0.88x |
| alice29.txt (10000B) | 66.48% | 6.23% | 0.16x | 0.89x |
| alice29.txt (20000B) | 63.43% | 8.69% | 0.29x | 0.89x |
Except for the mostly incompressible JPEG image compression is better and usually in the Except for the mostly incompressible JPEG image compression is better and usually in the
double digits in terms of percentage reduction over Snappy. double digits in terms of percentage reduction over Snappy.
@ -605,29 +567,29 @@ Some examples compared on 16 core CPU, amd64 assembly used:
``` ```
* enwik10 * enwik10
Default... 10000000000 -> 4761467548 [47.61%]; 1.098s, 8685.6MB/s Default... 10000000000 -> 4759950115 [47.60%]; 1.03s, 9263.0MB/s
Better... 10000000000 -> 4219438251 [42.19%]; 1.925s, 4954.2MB/s Better... 10000000000 -> 4084706676 [40.85%]; 2.16s, 4415.4MB/s
Best... 10000000000 -> 3627364337 [36.27%]; 43.051s, 221.5MB/s Best... 10000000000 -> 3615520079 [36.16%]; 42.259s, 225.7MB/s
* github-june-2days-2019.json * github-june-2days-2019.json
Default... 6273951764 -> 1043196283 [16.63%]; 431ms, 13882.3MB/s Default... 6273951764 -> 1041700255 [16.60%]; 431ms, 13882.3MB/s
Better... 6273951764 -> 949146808 [15.13%]; 547ms, 10938.4MB/s Better... 6273951764 -> 945841238 [15.08%]; 547ms, 10938.4MB/s
Best... 6273951764 -> 832855506 [13.27%]; 9.455s, 632.8MB/s Best... 6273951764 -> 826392576 [13.17%]; 9.455s, 632.8MB/s
* nyc-taxi-data-10M.csv * nyc-taxi-data-10M.csv
Default... 3325605752 -> 1095998837 [32.96%]; 324ms, 9788.7MB/s Default... 3325605752 -> 1093516949 [32.88%]; 324ms, 9788.7MB/s
Better... 3325605752 -> 954776589 [28.71%]; 491ms, 6459.4MB/s Better... 3325605752 -> 885394158 [26.62%]; 491ms, 6459.4MB/s
Best... 3325605752 -> 779098746 [23.43%]; 8.29s, 382.6MB/s Best... 3325605752 -> 773681257 [23.26%]; 8.29s, 412.0MB/s
* 10gb.tar * 10gb.tar
Default... 10065157632 -> 5916578242 [58.78%]; 1.028s, 9337.4MB/s Default... 10065157632 -> 5915541066 [58.77%]; 1.028s, 9337.4MB/s
Better... 10065157632 -> 5649207485 [56.13%]; 1.597s, 6010.6MB/s Better... 10065157632 -> 5453844650 [54.19%]; 1.597s, 4862.7MB/s
Best... 10065157632 -> 5208719802 [51.75%]; 32.78s, 292.8MB/ Best... 10065157632 -> 5192495021 [51.59%]; 32.78s, 308.2MB/
* consensus.db.10gb * consensus.db.10gb
Default... 10737418240 -> 4562648848 [42.49%]; 882ms, 11610.0MB/s Default... 10737418240 -> 4549762344 [42.37%]; 882ms, 12118.4MB/s
Better... 10737418240 -> 4542428129 [42.30%]; 1.533s, 6679.7MB/s Better... 10737418240 -> 4438535064 [41.34%]; 1.533s, 3500.9MB/s
Best... 10737418240 -> 4244773384 [39.53%]; 42.96s, 238.4MB/s Best... 10737418240 -> 4210602774 [39.21%]; 42.96s, 254.4MB/s
``` ```
Decompression speed should be around the same as using the 'better' compression mode. Decompression speed should be around the same as using the 'better' compression mode.
@ -649,7 +611,7 @@ Snappy compatible blocks can be generated with the S2 encoder.
Compression and speed is typically a bit better `MaxEncodedLen` is also smaller for smaller memory usage. Replace Compression and speed is typically a bit better `MaxEncodedLen` is also smaller for smaller memory usage. Replace
| Snappy | S2 replacement | | Snappy | S2 replacement |
|----------------------------|-------------------------| |---------------------------|-----------------------|
| snappy.Encode(...) | s2.EncodeSnappy(...) | | snappy.Encode(...) | s2.EncodeSnappy(...) |
| snappy.MaxEncodedLen(...) | s2.MaxEncodedLen(...) | | snappy.MaxEncodedLen(...) | s2.MaxEncodedLen(...) |
@ -661,11 +623,11 @@ Comparison of [`webdevdata.org-2015-01-07-subset`](https://files.klauspost.com/c
53927 files, total input size: 4,014,735,833 bytes. amd64, single goroutine used: 53927 files, total input size: 4,014,735,833 bytes. amd64, single goroutine used:
| Encoder | Size | MB/s | Reduction | | Encoder | Size | MB/s | Reduction |
|-----------------------|------------|------------|------------ |-----------------------|------------|------------|------------|
| snappy.Encode | 1128706759 | 725.59 | 71.89% | | snappy.Encode | 1128706759 | 725.59 | 71.89% |
| s2.EncodeSnappy | 1093823291 | **899.16** | 72.75% | | s2.EncodeSnappy | 1093823291 | **899.16** | 72.75% |
| s2.EncodeSnappyBetter | 1001158548 | 578.49 | 75.06% | | s2.EncodeSnappyBetter | 1001158548 | 578.49 | 75.06% |
| s2.EncodeSnappyBest | 944507998 | 66.00 | **76.47%**| | s2.EncodeSnappyBest | 944507998 | 66.00 | **76.47%** |
## Streams ## Streams
@ -835,6 +797,13 @@ This is done using the regular "Skip" function:
This will ensure that we are at exactly the offset we want, and reading from `dec` will start at the requested offset. This will ensure that we are at exactly the offset we want, and reading from `dec` will start at the requested offset.
# Compact storage
For compact storage [RemoveIndexHeaders](https://pkg.go.dev/github.com/klauspost/compress/s2#RemoveIndexHeaders) can be used to remove any redundant info from
a serialized index. If you remove the header it must be restored before [Loading](https://pkg.go.dev/github.com/klauspost/compress/s2#Index.Load).
This is expected to save 20 bytes. These can be restored using [RestoreIndexHeaders](https://pkg.go.dev/github.com/klauspost/compress/s2#RestoreIndexHeaders). This removes a layer of security, but is the most compact representation. Returns nil if headers contains errors.
## Index Format: ## Index Format:
Each block is structured as a snappy skippable block, with the chunk ID 0x99. Each block is structured as a snappy skippable block, with the chunk ID 0x99.
@ -845,7 +814,7 @@ Numbers are stored as fixed size little endian values or [zigzag encoded](https:
with un-encoded value length of 64 bits, unless other limits are specified. with un-encoded value length of 64 bits, unless other limits are specified.
| Content | Format | | Content | Format |
|---------------------------------------------------------------------------|-----------------------------------------------------------------------------------------------------------------------------| |--------------------------------------|-------------------------------------------------------------------------------------------------------------------------------|
| ID, `[1]byte` | Always 0x99. | | ID, `[1]byte` | Always 0x99. |
| Data Length, `[3]byte` | 3 byte little-endian length of the chunk in bytes, following this. | | Data Length, `[3]byte` | 3 byte little-endian length of the chunk in bytes, following this. |
| Header `[6]byte` | Header, must be `[115, 50, 105, 100, 120, 0]` or in text: "s2idx\x00". | | Header `[6]byte` | Header, must be `[115, 50, 105, 100, 120, 0]` or in text: "s2idx\x00". |
@ -929,6 +898,7 @@ To decode from any given uncompressed offset `(wantOffset)`:
See [using indexes](https://github.com/klauspost/compress/tree/master/s2#using-indexes) for functions that perform the operations with a simpler interface. See [using indexes](https://github.com/klauspost/compress/tree/master/s2#using-indexes) for functions that perform the operations with a simpler interface.
# Format Extensions # Format Extensions
* Frame [Stream identifier](https://github.com/google/snappy/blob/master/framing_format.txt#L68) changed from `sNaPpY` to `S2sTwO`. * Frame [Stream identifier](https://github.com/google/snappy/blob/master/framing_format.txt#L68) changed from `sNaPpY` to `S2sTwO`.
@ -951,10 +921,11 @@ The length is specified by reading the 3-bit length specified in the tag and dec
| 7 | 65540 + read 3 bytes | | 7 | 65540 + read 3 bytes |
This allows any repeat offset + length to be represented by 2 to 5 bytes. This allows any repeat offset + length to be represented by 2 to 5 bytes.
It also allows to emit matches longer than 64 bytes with one copy + one repeat instead of several 64 byte copies.
Lengths are stored as little endian values. Lengths are stored as little endian values.
The first copy of a block cannot be a repeat offset and the offset is not carried across blocks in streams. The first copy of a block cannot be a repeat offset and the offset is reset on every block in streams.
Default streaming block size is 1MB. Default streaming block size is 1MB.

View file

@ -952,8 +952,12 @@ func (r *Reader) ReadSeeker(random bool, index []byte) (*ReadSeeker, error) {
// Seek allows seeking in compressed data. // Seek allows seeking in compressed data.
func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) { func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) {
if r.err != nil { if r.err != nil {
if !errors.Is(r.err, io.EOF) {
return 0, r.err return 0, r.err
} }
// Reset on EOF
r.err = nil
}
if offset == 0 && whence == io.SeekCurrent { if offset == 0 && whence == io.SeekCurrent {
return r.blockStart + int64(r.i), nil return r.blockStart + int64(r.i), nil
} }

View file

@ -28,6 +28,9 @@ func s2Decode(dst, src []byte) int {
// As long as we can read at least 5 bytes... // As long as we can read at least 5 bytes...
for s < len(src)-5 { for s < len(src)-5 {
// Removing bounds checks is SLOWER, when if doing
// in := src[s:s+5]
// Checked on Go 1.18
switch src[s] & 0x03 { switch src[s] & 0x03 {
case tagLiteral: case tagLiteral:
x := uint32(src[s] >> 2) x := uint32(src[s] >> 2)
@ -38,14 +41,19 @@ func s2Decode(dst, src []byte) int {
s += 2 s += 2
x = uint32(src[s-1]) x = uint32(src[s-1])
case x == 61: case x == 61:
in := src[s : s+3]
x = uint32(in[1]) | uint32(in[2])<<8
s += 3 s += 3
x = uint32(src[s-2]) | uint32(src[s-1])<<8
case x == 62: case x == 62:
in := src[s : s+4]
// Load as 32 bit and shift down.
x = uint32(in[0]) | uint32(in[1])<<8 | uint32(in[2])<<16 | uint32(in[3])<<24
x >>= 8
s += 4 s += 4
x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16
case x == 63: case x == 63:
in := src[s : s+5]
x = uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24
s += 5 s += 5
x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24
} }
length = int(x) + 1 length = int(x) + 1
if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) { if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) {
@ -62,8 +70,8 @@ func s2Decode(dst, src []byte) int {
case tagCopy1: case tagCopy1:
s += 2 s += 2
length = int(src[s-2]) >> 2 & 0x7
toffset := int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) toffset := int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1]))
length = int(src[s-2]) >> 2 & 0x7
if toffset == 0 { if toffset == 0 {
if debug { if debug {
fmt.Print("(repeat) ") fmt.Print("(repeat) ")
@ -71,14 +79,16 @@ func s2Decode(dst, src []byte) int {
// keep last offset // keep last offset
switch length { switch length {
case 5: case 5:
length = int(src[s]) + 4
s += 1 s += 1
length = int(uint32(src[s-1])) + 4
case 6: case 6:
in := src[s : s+2]
length = int(uint32(in[0])|(uint32(in[1])<<8)) + (1 << 8)
s += 2 s += 2
length = int(uint32(src[s-2])|(uint32(src[s-1])<<8)) + (1 << 8)
case 7: case 7:
in := src[s : s+3]
length = int((uint32(in[2])<<16)|(uint32(in[1])<<8)|uint32(in[0])) + (1 << 16)
s += 3 s += 3
length = int(uint32(src[s-3])|(uint32(src[s-2])<<8)|(uint32(src[s-1])<<16)) + (1 << 16)
default: // 0-> 4 default: // 0-> 4
} }
} else { } else {
@ -86,14 +96,16 @@ func s2Decode(dst, src []byte) int {
} }
length += 4 length += 4
case tagCopy2: case tagCopy2:
in := src[s : s+3]
offset = int(uint32(in[1]) | uint32(in[2])<<8)
length = 1 + int(in[0])>>2
s += 3 s += 3
length = 1 + int(src[s-3])>>2
offset = int(uint32(src[s-2]) | uint32(src[s-1])<<8)
case tagCopy4: case tagCopy4:
in := src[s : s+5]
offset = int(uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24)
length = 1 + int(in[0])>>2
s += 5 s += 5
length = 1 + int(src[s-5])>>2
offset = int(uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24)
} }
if offset <= 0 || d < offset || length > len(dst)-d { if offset <= 0 || d < offset || length > len(dst)-d {

View file

@ -58,6 +58,7 @@ func encodeGo(dst, src []byte) []byte {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockGo(dst, src []byte) (d int) { func encodeBlockGo(dst, src []byte) (d int) {

View file

@ -8,6 +8,7 @@ package s2
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlock(dst, src []byte) (d int) { func encodeBlock(dst, src []byte) (d int) {
@ -43,6 +44,7 @@ func encodeBlock(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBetter(dst, src []byte) (d int) { func encodeBlockBetter(dst, src []byte) (d int) {
@ -78,6 +80,7 @@ func encodeBlockBetter(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockSnappy(dst, src []byte) (d int) { func encodeBlockSnappy(dst, src []byte) (d int) {
@ -112,6 +115,7 @@ func encodeBlockSnappy(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBetterSnappy(dst, src []byte) (d int) { func encodeBlockBetterSnappy(dst, src []byte) (d int) {

View file

@ -15,6 +15,7 @@ import (
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBest(dst, src []byte) (d int) { func encodeBlockBest(dst, src []byte) (d int) {
@ -176,14 +177,21 @@ func encodeBlockBest(dst, src []byte) (d int) {
best = bestOf(best, matchAt(getPrev(nextLong), s, uint32(cv), false)) best = bestOf(best, matchAt(getPrev(nextLong), s, uint32(cv), false))
} }
// Search for a match at best match end, see if that is better. // Search for a match at best match end, see if that is better.
if sAt := best.s + best.length; sAt < sLimit { // Allow some bytes at the beginning to mismatch.
sBack := best.s // Sweet spot is around 1-2 bytes, but depends on input.
backL := best.length // The skipped bytes are tested in Extend backwards,
// and still picked up as part of the match if they do.
const skipBeginning = 2
const skipEnd = 1
if sAt := best.s + best.length - skipEnd; sAt < sLimit {
sBack := best.s + skipBeginning - skipEnd
backL := best.length - skipBeginning
// Load initial values // Load initial values
cv = load64(src, sBack) cv = load64(src, sBack)
// Search for mismatch
// Grab candidates...
next := lTable[hash8(load64(src, sAt), lTableBits)] next := lTable[hash8(load64(src, sAt), lTableBits)]
//next := sTable[hash4(load64(src, sAt), sTableBits)]
if checkAt := getCur(next) - backL; checkAt > 0 { if checkAt := getCur(next) - backL; checkAt > 0 {
best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false))
@ -191,6 +199,16 @@ func encodeBlockBest(dst, src []byte) (d int) {
if checkAt := getPrev(next) - backL; checkAt > 0 { if checkAt := getPrev(next) - backL; checkAt > 0 {
best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false))
} }
// Disabled: Extremely small gain
if false {
next = sTable[hash4(load64(src, sAt), sTableBits)]
if checkAt := getCur(next) - backL; checkAt > 0 {
best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false))
}
if checkAt := getPrev(next) - backL; checkAt > 0 {
best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false))
}
}
} }
} }
} }
@ -288,6 +306,7 @@ emitRemainder:
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBestSnappy(dst, src []byte) (d int) { func encodeBlockBestSnappy(dst, src []byte) (d int) {
@ -546,6 +565,7 @@ emitRemainder:
// emitCopySize returns the size to encode the offset+length // emitCopySize returns the size to encode the offset+length
// //
// It assumes that: // It assumes that:
//
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
func emitCopySize(offset, length int) int { func emitCopySize(offset, length int) int {
@ -584,6 +604,7 @@ func emitCopySize(offset, length int) int {
// emitCopyNoRepeatSize returns the size to encode the offset+length // emitCopyNoRepeatSize returns the size to encode the offset+length
// //
// It assumes that: // It assumes that:
//
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
func emitCopyNoRepeatSize(offset, length int) int { func emitCopyNoRepeatSize(offset, length int) int {

View file

@ -42,6 +42,7 @@ func hash8(u uint64, h uint8) uint32 {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBetterGo(dst, src []byte) (d int) { func encodeBlockBetterGo(dst, src []byte) (d int) {
@ -56,7 +57,7 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
// Initialize the hash tables. // Initialize the hash tables.
const ( const (
// Long hash matches. // Long hash matches.
lTableBits = 16 lTableBits = 17
maxLTableSize = 1 << lTableBits maxLTableSize = 1 << lTableBits
// Short hash matches. // Short hash matches.
@ -97,9 +98,26 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
lTable[hashL] = uint32(s) lTable[hashL] = uint32(s)
sTable[hashS] = uint32(s) sTable[hashS] = uint32(s)
valLong := load64(src, candidateL)
valShort := load64(src, candidateS)
// If long matches at least 8 bytes, use that.
if cv == valLong {
break
}
if cv == valShort {
candidateL = candidateS
break
}
// Check repeat at offset checkRep. // Check repeat at offset checkRep.
const checkRep = 1 const checkRep = 1
if false && uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { // Minimum length of a repeat. Tested with various values.
// While 4-5 offers improvements in some, 6 reduces
// regressions significantly.
const wantRepeatBytes = 6
const repeatMask = ((1 << (wantRepeatBytes * 8)) - 1) << (8 * checkRep)
if false && repeat > 0 && cv&repeatMask == load64(src, s-repeat)&repeatMask {
base := s + checkRep base := s + checkRep
// Extend back // Extend back
for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; {
@ -109,8 +127,8 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
d += emitLiteral(dst[d:], src[nextEmit:base]) d += emitLiteral(dst[d:], src[nextEmit:base])
// Extend forward // Extend forward
candidate := s - repeat + 4 + checkRep candidate := s - repeat + wantRepeatBytes + checkRep
s += 4 + checkRep s += wantRepeatBytes + checkRep
for s < len(src) { for s < len(src) {
if len(src)-s < 8 { if len(src)-s < 8 {
if src[s] == src[candidate] { if src[s] == src[candidate] {
@ -127,28 +145,40 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
s += 8 s += 8
candidate += 8 candidate += 8
} }
if nextEmit > 0 {
// same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset.
d += emitRepeat(dst[d:], repeat, s-base) d += emitRepeat(dst[d:], repeat, s-base)
} else {
// First match, cannot be repeat.
d += emitCopy(dst[d:], repeat, s-base)
}
nextEmit = s nextEmit = s
if s >= sLimit { if s >= sLimit {
goto emitRemainder goto emitRemainder
} }
// Index in-between
index0 := base + 1
index1 := s - 2
cv = load64(src, s)
for index0 < index1 {
cv0 := load64(src, index0)
cv1 := load64(src, index1)
lTable[hash7(cv0, lTableBits)] = uint32(index0)
sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1)
lTable[hash7(cv1, lTableBits)] = uint32(index1)
sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1)
index0 += 2
index1 -= 2
}
cv = load64(src, s) cv = load64(src, s)
continue continue
} }
if uint32(cv) == load32(src, candidateL) { // Long likely matches 7, so take that.
if uint32(cv) == uint32(valLong) {
break break
} }
// Check our short candidate // Check our short candidate
if uint32(cv) == load32(src, candidateS) { if uint32(cv) == uint32(valShort) {
// Try a long candidate at s+1 // Try a long candidate at s+1
hashL = hash7(cv>>8, lTableBits) hashL = hash7(cv>>8, lTableBits)
candidateL = int(lTable[hashL]) candidateL = int(lTable[hashL])
@ -227,21 +257,29 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
// Do we have space for more, if not bail. // Do we have space for more, if not bail.
return 0 return 0
} }
// Index match start+1 (long) and start+2 (short)
// Index short & long
index0 := base + 1 index0 := base + 1
// Index match end-2 (long) and end-1 (short)
index1 := s - 2 index1 := s - 2
cv0 := load64(src, index0) cv0 := load64(src, index0)
cv1 := load64(src, index1) cv1 := load64(src, index1)
cv = load64(src, s)
lTable[hash7(cv0, lTableBits)] = uint32(index0) lTable[hash7(cv0, lTableBits)] = uint32(index0)
lTable[hash7(cv0>>8, lTableBits)] = uint32(index0 + 1)
lTable[hash7(cv1, lTableBits)] = uint32(index1)
lTable[hash7(cv1>>8, lTableBits)] = uint32(index1 + 1)
sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1)
sTable[hash4(cv0>>16, sTableBits)] = uint32(index0 + 2)
lTable[hash7(cv1, lTableBits)] = uint32(index1)
sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1)
index0 += 1
index1 -= 1
cv = load64(src, s)
// index every second long in between.
for index0 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
index0 += 2
index1 -= 2
}
} }
emitRemainder: emitRemainder:
@ -260,6 +298,7 @@ emitRemainder:
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) && // len(dst) >= MaxEncodedLen(len(src)) &&
// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize // minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize
func encodeBlockBetterSnappyGo(dst, src []byte) (d int) { func encodeBlockBetterSnappyGo(dst, src []byte) (d int) {
@ -402,21 +441,29 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) {
// Do we have space for more, if not bail. // Do we have space for more, if not bail.
return 0 return 0
} }
// Index match start+1 (long) and start+2 (short)
// Index short & long
index0 := base + 1 index0 := base + 1
// Index match end-2 (long) and end-1 (short)
index1 := s - 2 index1 := s - 2
cv0 := load64(src, index0) cv0 := load64(src, index0)
cv1 := load64(src, index1) cv1 := load64(src, index1)
cv = load64(src, s)
lTable[hash7(cv0, lTableBits)] = uint32(index0) lTable[hash7(cv0, lTableBits)] = uint32(index0)
lTable[hash7(cv0>>8, lTableBits)] = uint32(index0 + 1)
lTable[hash7(cv1, lTableBits)] = uint32(index1)
lTable[hash7(cv1>>8, lTableBits)] = uint32(index1 + 1)
sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1)
sTable[hash4(cv0>>16, sTableBits)] = uint32(index0 + 2)
lTable[hash7(cv1, lTableBits)] = uint32(index1)
sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1)
index0 += 1
index1 -= 1
cv = load64(src, s)
// index every second long in between.
for index0 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
index0 += 2
index1 -= 2
}
} }
emitRemainder: emitRemainder:

View file

@ -12,6 +12,7 @@ import (
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) // len(dst) >= MaxEncodedLen(len(src))
func encodeBlock(dst, src []byte) (d int) { func encodeBlock(dst, src []byte) (d int) {
if len(src) < minNonLiteralBlockSize { if len(src) < minNonLiteralBlockSize {
@ -25,6 +26,7 @@ func encodeBlock(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) // len(dst) >= MaxEncodedLen(len(src))
func encodeBlockBetter(dst, src []byte) (d int) { func encodeBlockBetter(dst, src []byte) (d int) {
return encodeBlockBetterGo(dst, src) return encodeBlockBetterGo(dst, src)
@ -35,6 +37,7 @@ func encodeBlockBetter(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) // len(dst) >= MaxEncodedLen(len(src))
func encodeBlockBetterSnappy(dst, src []byte) (d int) { func encodeBlockBetterSnappy(dst, src []byte) (d int) {
return encodeBlockBetterSnappyGo(dst, src) return encodeBlockBetterSnappyGo(dst, src)
@ -45,6 +48,7 @@ func encodeBlockBetterSnappy(dst, src []byte) (d int) {
// been written. // been written.
// //
// It also assumes that: // It also assumes that:
//
// len(dst) >= MaxEncodedLen(len(src)) // len(dst) >= MaxEncodedLen(len(src))
func encodeBlockSnappy(dst, src []byte) (d int) { func encodeBlockSnappy(dst, src []byte) (d int) {
if len(src) < minNonLiteralBlockSize { if len(src) < minNonLiteralBlockSize {
@ -56,6 +60,7 @@ func encodeBlockSnappy(dst, src []byte) (d int) {
// emitLiteral writes a literal chunk and returns the number of bytes written. // emitLiteral writes a literal chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes // dst is long enough to hold the encoded bytes
// 0 <= len(lit) && len(lit) <= math.MaxUint32 // 0 <= len(lit) && len(lit) <= math.MaxUint32
func emitLiteral(dst, lit []byte) int { func emitLiteral(dst, lit []byte) int {
@ -146,6 +151,7 @@ func emitRepeat(dst []byte, offset, length int) int {
// emitCopy writes a copy chunk and returns the number of bytes written. // emitCopy writes a copy chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes // dst is long enough to hold the encoded bytes
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
@ -214,6 +220,7 @@ func emitCopy(dst []byte, offset, length int) int {
// emitCopyNoRepeat writes a copy chunk and returns the number of bytes written. // emitCopyNoRepeat writes a copy chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes // dst is long enough to hold the encoded bytes
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
@ -273,8 +280,8 @@ func emitCopyNoRepeat(dst []byte, offset, length int) int {
// matchLen returns how many bytes match in a and b // matchLen returns how many bytes match in a and b
// //
// It assumes that: // It assumes that:
// len(a) <= len(b)
// //
// len(a) <= len(b)
func matchLen(a []byte, b []byte) int { func matchLen(a []byte, b []byte) int {
b = b[:len(a)] b = b[:len(a)]
var checked int var checked int

View file

@ -1,7 +1,6 @@
// Code generated by command: go run gen.go -out ../encodeblock_amd64.s -stubs ../encodeblock_amd64.go -pkg=s2. DO NOT EDIT. // Code generated by command: go run gen.go -out ../encodeblock_amd64.s -stubs ../encodeblock_amd64.go -pkg=s2. DO NOT EDIT.
//go:build !appengine && !noasm && gc && !noasm //go:build !appengine && !noasm && gc && !noasm
// +build !appengine,!noasm,gc,!noasm
package s2 package s2
@ -150,6 +149,7 @@ func encodeSnappyBetterBlockAsm8B(dst []byte, src []byte) int
// emitLiteral writes a literal chunk and returns the number of bytes written. // emitLiteral writes a literal chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes with margin of 0 bytes // dst is long enough to hold the encoded bytes with margin of 0 bytes
// 0 <= len(lit) && len(lit) <= math.MaxUint32 // 0 <= len(lit) && len(lit) <= math.MaxUint32
// //
@ -165,6 +165,7 @@ func emitRepeat(dst []byte, offset int, length int) int
// emitCopy writes a copy chunk and returns the number of bytes written. // emitCopy writes a copy chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes // dst is long enough to hold the encoded bytes
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
@ -175,6 +176,7 @@ func emitCopy(dst []byte, offset int, length int) int
// emitCopyNoRepeat writes a copy chunk and returns the number of bytes written. // emitCopyNoRepeat writes a copy chunk and returns the number of bytes written.
// //
// It assumes that: // It assumes that:
//
// dst is long enough to hold the encoded bytes // dst is long enough to hold the encoded bytes
// 1 <= offset && offset <= math.MaxUint32 // 1 <= offset && offset <= math.MaxUint32
// 4 <= length && length <= 1 << 24 // 4 <= length && length <= 1 << 24
@ -185,6 +187,7 @@ func emitCopyNoRepeat(dst []byte, offset int, length int) int
// matchLen returns how many bytes match in a and b // matchLen returns how many bytes match in a and b
// //
// It assumes that: // It assumes that:
//
// len(a) <= len(b) // len(a) <= len(b)
// //
//go:noescape //go:noescape

File diff suppressed because it is too large Load diff

View file

@ -17,9 +17,16 @@ Package home: https://github.com/klauspost/cpuid
## installing ## installing
`go get -u github.com/klauspost/cpuid/v2` using modules. `go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others. Drop `v2` for others.
### Homebrew
For macOS/Linux users, you can install via [brew](https://brew.sh/)
```sh
$ brew install cpuid
```
## example ## example
```Go ```Go
@ -77,10 +84,14 @@ We have Streaming SIMD 2 Extensions
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
Note that for some cpu/os combinations some features will not be detected. Note that for some cpu/os combinations some features will not be detected.
`amd64` has rather good support and should work reliably on all platforms. `amd64` has rather good support and should work reliably on all platforms.
Note that hypervisors may not pass through all CPU features. Note that hypervisors may not pass through all CPU features through to the guest OS,
so even if your host supports a feature it may not be visible on guests.
## arm64 feature detection ## arm64 feature detection
@ -253,6 +264,218 @@ Exit Code 0
Exit Code 1 Exit Code 1
``` ```
## Available flags
### x86 & amd64
| Feature Flag | Description |
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
| AESNI | Advanced Encryption Standard New Instructions |
| AMD3DNOW | AMD 3DNOW |
| AMD3DNOWEXT | AMD 3DNowExt |
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture |
| AVX | AVX functions |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
| AVX512BW | AVX-512 Byte and Word Instructions |
| AVX512CD | AVX-512 Conflict Detection Instructions |
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
| AVX512F | AVX-512 Foundation |
| AVX512FP16 | AVX-512 FP16 Instructions |
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
| AVX512PF | AVX-512 Prefetch Instructions |
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
| AVX512VL | AVX-512 Vector Length Extensions |
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
| AVXIFMA | AVX-IFMA instructions |
| AVXNECONVERT | AVX-NE-CONVERT instructions |
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
| CETIBT | Intel CET Indirect Branch Tracking |
| CETSS | Intel CET Shadow Stack |
| CLDEMOTE | Cache Line Demote |
| CLMUL | Carry-less Multiplication |
| CLZERO | CLZERO instruction supported |
| CMOV | i686 CMOV |
| CMPCCXADD | CMPCCXADD instructions |
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
| CMPXCHG8 | CMPXCHG8 instruction |
| CPBOOST | Core Performance Boost |
| CPPC | AMD: Collaborative Processor Performance Control |
| CX16 | CMPXCHG16B Instruction |
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
| ENQCMD | Enqueue Command |
| ERMS | Enhanced REP MOVSB/STOSB |
| F16C | Half-precision floating-point conversion |
| FLUSH_L1D | Flush L1D cache |
| FMA3 | Intel FMA 3. Does not imply AVX. |
| FMA4 | Bulldozer FMA4 functions |
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
| FSRM | Fast Short Rep Mov |
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
| FXSROPT | FXSAVE/FXRSTOR optimizations |
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
| HLE | Hardware Lock Elision |
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
| HTT | Hyperthreading (enabled) |
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
| HYBRID_CPU | This part has CPUs of more than one type. |
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
| IBRS | AMD: Indirect Branch Restricted Speculation |
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
| IBS | Instruction Based Sampling (AMD) |
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
| IBSFFV | Instruction Based Sampling Feature (AMD) |
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
| LZCNT | LZCNT instruction |
| MCAOVERFLOW | MCA overflow recovery support. |
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
| MCOMMIT | MCOMMIT instruction supported |
| MD_CLEAR | VERW clears CPU buffers |
| MMX | standard MMX |
| MMXEXT | SSE integer functions or AMD MMX ext |
| MOVBE | MOVBE instruction (big-endian) |
| MOVDIR64B | Move 64 Bytes as Direct Store |
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSR_PAGEFLUSH | Page Flush MSR available |
| NRIPS | Indicates support for NRIP save on VMEXIT |
| NX | NX (No-Execute) bit |
| OSXSAVE | XSAVE enabled by OS |
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
| POPCNT | POPCNT instruction |
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | AMD: Predictive Store Forward Disable |
| RDPRU | RDPRU instruction supported |
| RDRAND | RDRAND instruction is available |
| RDSEED | RDSEED instruction is available |
| RDTSCP | RDTSCP Instruction |
| RTM | Restricted Transactional Memory |
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
| SERIALIZE | Serialize Instruction Execution |
| SEV | AMD Secure Encrypted Virtualization supported |
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
| SEV_ES | AMD SEV Encrypted State supported |
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
| SEV_SNP | AMD SEV Secure Nested Paging supported |
| SGX | Software Guard Extensions |
| SGXLC | Software Guard Extensions Launch Control |
| SHA | Intel SHA Extensions |
| SME | AMD Secure Memory Encryption supported |
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
| SRBDS_CTRL | SRBDS mitigation MSR available |
| SSE | SSE functions |
| SSE2 | P4 SSE functions |
| SSE3 | Prescott SSE3 functions |
| SSE4 | Penryn SSE4.1 functions |
| SSE42 | Nehalem SSE4.2 functions |
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
| SSSE3 | Conroe SSSE3 functions |
| STIBP | Single Thread Indirect Branch Predictors |
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
| STOSB_SHORT | Fast short STOSB |
| SUCCOR | Software uncorrectable error containment and recovery capability. |
| SVM | AMD Secure Virtual Machine |
| SVMDA | Indicates support for the SVM decode assists. |
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
| SVMNP | AMD SVM nested paging |
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
| VAES | Vector AES. AVX(512) versions requires additional checks. |
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
| VMPL | AMD VM Permission Levels supported |
| VMSA_REGPROT | AMD VMSA Register Protection supported |
| VMX | Virtual Machine Extensions |
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
| VTE | AMD Virtual Transparent Encryption supported |
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
| WBNOINVD | Write Back and Do Not Invalidate Cache |
| X87 | FPU |
| XGETBV1 | Supports XGETBV with ECX = 1 |
| XOP | Bulldozer XOP functions |
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
| XSAVEOPT | XSAVEOPT available |
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
# ARM features:
| Feature Flag | Description |
|--------------|------------------------------------------------------------------|
| AESARM | AES instructions |
| ARMCPUID | Some CPU ID registers readable at user-level |
| ASIMD | Advanced SIMD |
| ASIMDDP | SIMD Dot Product |
| ASIMDHP | Advanced SIMD half-precision floating point |
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
| ATOMICS | Large System Extensions (LSE) |
| CRC32 | CRC32/CRC32C instructions |
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
| EVTSTRM | Generic timer |
| FCMA | Floatin point complex number addition and multiplication |
| FP | Single-precision and double-precision floating point |
| FPHP | Half-precision floating point |
| GPA | Generic Pointer Authentication |
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
| LRCPC | Weaker release consistency (LDAPR, etc) |
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
| SHA1 | SHA-1 instructions (SHA1C, etc) |
| SHA2 | SHA-2 instructions (SHA256H, etc) |
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
| SHA512 | SHA512 instructions |
| SM3 | SM3 instructions |
| SM4 | SM4 instructions |
| SVE | Scalable Vector Extension |
# license # license
This code is published under an MIT license. See LICENSE file for more information. This code is published under an MIT license. See LICENSE file for more information.

View file

@ -73,6 +73,7 @@ const (
AMD3DNOW // AMD 3DNOW AMD3DNOW // AMD 3DNOW
AMD3DNOWEXT // AMD 3DNowExt AMD3DNOWEXT // AMD 3DNowExt
AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXBF16 // Tile computational operations on BFLOAT16 numbers
AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture AMXTILE // Tile architecture
AVX // AVX functions AVX // AVX functions
@ -93,8 +94,11 @@ const (
AVX512VNNI // AVX-512 Vector Neural Network Instructions AVX512VNNI // AVX-512 Vector Neural Network Instructions
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
AVXIFMA // AVX-IFMA instructions
AVXNECONVERT // AVX-NE-CONVERT instructions
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
BMI1 // Bit Manipulation Instruction Set 1 BMI1 // Bit Manipulation Instruction Set 1
BMI2 // Bit Manipulation Instruction Set 2 BMI2 // Bit Manipulation Instruction Set 2
CETIBT // Intel CET Indirect Branch Tracking CETIBT // Intel CET Indirect Branch Tracking
@ -103,16 +107,21 @@ const (
CLMUL // Carry-less Multiplication CLMUL // Carry-less Multiplication
CLZERO // CLZERO instruction supported CLZERO // CLZERO instruction supported
CMOV // i686 CMOV CMOV // i686 CMOV
CMPCCXADD // CMPCCXADD instructions
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
CMPXCHG8 // CMPXCHG8 instruction CMPXCHG8 // CMPXCHG8 instruction
CPBOOST // Core Performance Boost CPBOOST // Core Performance Boost
CPPC // AMD: Collaborative Processor Performance Control
CX16 // CMPXCHG16B Instruction CX16 // CMPXCHG16B Instruction
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
ENQCMD // Enqueue Command ENQCMD // Enqueue Command
ERMS // Enhanced REP MOVSB/STOSB ERMS // Enhanced REP MOVSB/STOSB
F16C // Half-precision floating-point conversion F16C // Half-precision floating-point conversion
FLUSH_L1D // Flush L1D cache FLUSH_L1D // Flush L1D cache
FMA3 // Intel FMA 3. Does not imply AVX. FMA3 // Intel FMA 3. Does not imply AVX.
FMA4 // Bulldozer FMA4 functions FMA4 // Bulldozer FMA4 functions
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
FSRM // Fast Short Rep Mov FSRM // Fast Short Rep Mov
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
FXSROPT // FXSAVE/FXRSTOR optimizations FXSROPT // FXSAVE/FXRSTOR optimizations
@ -126,6 +135,9 @@ const (
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
IBRS // AMD: Indirect Branch Restricted Speculation
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
IBS // Instruction Based Sampling (AMD) IBS // Instruction Based Sampling (AMD)
IBSBRNTRGT // Instruction Based Sampling Feature (AMD) IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
IBSFETCHSAM // Instruction Based Sampling Feature (AMD) IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
@ -135,7 +147,11 @@ const (
IBSOPSAM // Instruction Based Sampling Feature (AMD) IBSOPSAM // Instruction Based Sampling Feature (AMD)
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
IBS_PREVENTHOST // Disallowing IBS use by the host supported IBS_PREVENTHOST // Disallowing IBS use by the host supported
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
INT_WBINVD // WBINVD/WBNOINVD are interruptible. INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported INVLPGB // NVLPGB and TLBSYNC instruction supported
LAHF // LAHF/SAHF in long mode LAHF // LAHF/SAHF in long mode
@ -152,6 +168,7 @@ const (
MOVDIR64B // Move 64 Bytes as Direct Store MOVDIR64B // Move 64 Bytes as Direct Store
MOVDIRI // Move Doubleword as Direct Store MOVDIRI // Move Doubleword as Direct Store
MOVSB_ZL // Fast Zero-Length MOVSB MOVSB_ZL // Fast Zero-Length MOVSB
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
MPX // Intel MPX (Memory Protection Extensions) MPX // Intel MPX (Memory Protection Extensions)
MSRIRC // Instruction Retired Counter MSR available MSRIRC // Instruction Retired Counter MSR available
MSR_PAGEFLUSH // Page Flush MSR available MSR_PAGEFLUSH // Page Flush MSR available
@ -160,6 +177,9 @@ const (
OSXSAVE // XSAVE enabled by OS OSXSAVE // XSAVE enabled by OS
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
POPCNT // POPCNT instruction POPCNT // POPCNT instruction
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
PREFETCHI // PREFETCHIT0/1 instructions
PSFD // AMD: Predictive Store Forward Disable
RDPRU // RDPRU instruction supported RDPRU // RDPRU instruction supported
RDRAND // RDRAND instruction is available RDRAND // RDRAND instruction is available
RDSEED // RDSEED instruction is available RDSEED // RDSEED instruction is available
@ -189,6 +209,7 @@ const (
SSE4A // AMD Barcelona microarchitecture SSE4a instructions SSE4A // AMD Barcelona microarchitecture SSE4a instructions
SSSE3 // Conroe SSSE3 functions SSSE3 // Conroe SSSE3 functions
STIBP // Single Thread Indirect Branch Predictors STIBP // Single Thread Indirect Branch Predictors
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
STOSB_SHORT // Fast short STOSB STOSB_SHORT // Fast short STOSB
SUCCOR // Software uncorrectable error containment and recovery capability. SUCCOR // Software uncorrectable error containment and recovery capability.
SVM // AMD Secure Virtual Machine SVM // AMD Secure Virtual Machine
@ -201,6 +222,7 @@ const (
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation TBM // AMD Trailing Bit Manipulation
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
@ -367,7 +389,7 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
// Has allows for checking a single feature. // Has allows for checking a single feature.
// Should be inlined by the compiler. // Should be inlined by the compiler.
func (c CPUInfo) Has(id FeatureID) bool { func (c *CPUInfo) Has(id FeatureID) bool {
return c.featureSet.inSet(id) return c.featureSet.inSet(id)
} }
@ -381,26 +403,47 @@ func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
return false return false
} }
// Features contains several features combined for a fast check using
// CpuInfo.HasAll
type Features *flagSet
// CombineFeatures allows to combine several features for a close to constant time lookup.
func CombineFeatures(ids ...FeatureID) Features {
var v flagSet
for _, id := range ids {
v.set(id)
}
return &v
}
func (c *CPUInfo) HasAll(f Features) bool {
return c.featureSet.hasSetP(f)
}
// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels // https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2) var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
// X64Level returns the microarchitecture level detected on the CPU. // X64Level returns the microarchitecture level detected on the CPU.
// If features are lacking or non x64 mode, 0 is returned. // If features are lacking or non x64 mode, 0 is returned.
// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels // See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
func (c CPUInfo) X64Level() int { func (c CPUInfo) X64Level() int {
if c.featureSet.hasSet(level4Features) { if !c.featureSet.hasOneOf(oneOfLevel) {
return 0
}
if c.featureSet.hasSetP(level4Features) {
return 4 return 4
} }
if c.featureSet.hasSet(level3Features) { if c.featureSet.hasSetP(level3Features) {
return 3 return 3
} }
if c.featureSet.hasSet(level2Features) { if c.featureSet.hasSetP(level2Features) {
return 2 return 2
} }
if c.featureSet.hasSet(level1Features) { if c.featureSet.hasSetP(level1Features) {
return 1 return 1
} }
return 0 return 0
@ -564,7 +607,7 @@ const flagMask = flagBits - 1
// flagSet contains detected cpu features and characteristics in an array of flags // flagSet contains detected cpu features and characteristics in an array of flags
type flagSet [(lastID + flagMask) / flagBits]flags type flagSet [(lastID + flagMask) / flagBits]flags
func (s flagSet) inSet(feat FeatureID) bool { func (s *flagSet) inSet(feat FeatureID) bool {
return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
} }
@ -594,7 +637,7 @@ func (s *flagSet) or(other flagSet) {
} }
// hasSet returns whether all features are present. // hasSet returns whether all features are present.
func (s flagSet) hasSet(other flagSet) bool { func (s *flagSet) hasSet(other flagSet) bool {
for i, v := range other[:] { for i, v := range other[:] {
if s[i]&v != v { if s[i]&v != v {
return false return false
@ -603,8 +646,28 @@ func (s flagSet) hasSet(other flagSet) bool {
return true return true
} }
// hasSet returns whether all features are present.
func (s *flagSet) hasSetP(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != v {
return false
}
}
return true
}
// hasOneOf returns whether one or more features are present.
func (s *flagSet) hasOneOf(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != 0 {
return true
}
}
return false
}
// nEnabled will return the number of enabled flags. // nEnabled will return the number of enabled flags.
func (s flagSet) nEnabled() (n int) { func (s *flagSet) nEnabled() (n int) {
for _, v := range s[:] { for _, v := range s[:] {
n += bits.OnesCount64(uint64(v)) n += bits.OnesCount64(uint64(v))
} }
@ -1118,13 +1181,20 @@ func support() flagSet {
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
// CPUID.(EAX=7, ECX=1) // CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx&(1<<14) != 0, PREFETCHI)
// CPUID.(EAX=7, ECX=1).EAX
eax1, _, _, _ := cpuidex(7, 1) eax1, _, _, _ := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
fs.setIf(eax1&(1<<22) != 0, HRESET) fs.setIf(eax1&(1<<22) != 0, HRESET)
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM) fs.setIf(eax1&(1<<26) != 0, LAM)
// Only detect AVX-512 features if XGETBV is supported // Only detect AVX-512 features if XGETBV is supported
@ -1162,6 +1232,7 @@ func support() flagSet {
fs.setIf(edx&(1<<25) != 0, AMXINT8) fs.setIf(edx&(1<<25) != 0, AMXINT8)
// eax1 = CPUID.(EAX=7, ECX=1).EAX // eax1 = CPUID.(EAX=7, ECX=1).EAX
fs.setIf(eax1&(1<<5) != 0, AVX512BF16) fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
} }
} }
@ -1234,9 +1305,21 @@ func support() flagSet {
if maxExtendedFunction() >= 0x80000008 { if maxExtendedFunction() >= 0x80000008 {
_, b, _, _ := cpuid(0x80000008) _, b, _, _ := cpuid(0x80000008)
fs.setIf(b&(1<<28) != 0, PSFD)
fs.setIf(b&(1<<27) != 0, CPPC)
fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
fs.setIf(b&(1<<23) != 0, PPIN)
fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
fs.setIf(b&(1<<15) != 0, STIBP)
fs.setIf(b&(1<<14) != 0, IBRS)
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf(b&(1<<12) != 0, IBPB)
fs.setIf((b&(1<<9)) != 0, WBNOINVD) fs.setIf((b&(1<<9)) != 0, WBNOINVD)
fs.setIf((b&(1<<8)) != 0, MCOMMIT) fs.setIf((b&(1<<8)) != 0, MCOMMIT)
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf((b&(1<<4)) != 0, RDPRU) fs.setIf((b&(1<<4)) != 0, RDPRU)
fs.setIf((b&(1<<3)) != 0, INVLPGB) fs.setIf((b&(1<<3)) != 0, INVLPGB)
fs.setIf((b&(1<<1)) != 0, MSRIRC) fs.setIf((b&(1<<1)) != 0, MSRIRC)
@ -1257,6 +1340,13 @@ func support() flagSet {
fs.setIf((edx>>12)&1 == 1, SVMPFT) fs.setIf((edx>>12)&1 == 1, SVMPFT)
} }
if maxExtendedFunction() >= 0x8000001a {
eax, _, _, _ := cpuid(0x8000001a)
fs.setIf((eax>>0)&1 == 1, FP128)
fs.setIf((eax>>1)&1 == 1, MOVU)
fs.setIf((eax>>2)&1 == 1, FP256)
}
if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
eax, _, _, _ := cpuid(0x8000001b) eax, _, _, _ := cpuid(0x8000001b)
fs.setIf((eax>>0)&1 == 1, IBSFFV) fs.setIf((eax>>0)&1 == 1, IBSFFV)
@ -1267,6 +1357,10 @@ func support() flagSet {
fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
} }
if maxExtendedFunction() >= 0x8000001f && vend == AMD { if maxExtendedFunction() >= 0x8000001f && vend == AMD {

View file

@ -13,185 +13,207 @@ func _() {
_ = x[AMD3DNOW-3] _ = x[AMD3DNOW-3]
_ = x[AMD3DNOWEXT-4] _ = x[AMD3DNOWEXT-4]
_ = x[AMXBF16-5] _ = x[AMXBF16-5]
_ = x[AMXINT8-6] _ = x[AMXFP16-6]
_ = x[AMXTILE-7] _ = x[AMXINT8-7]
_ = x[AVX-8] _ = x[AMXTILE-8]
_ = x[AVX2-9] _ = x[AVX-9]
_ = x[AVX512BF16-10] _ = x[AVX2-10]
_ = x[AVX512BITALG-11] _ = x[AVX512BF16-11]
_ = x[AVX512BW-12] _ = x[AVX512BITALG-12]
_ = x[AVX512CD-13] _ = x[AVX512BW-13]
_ = x[AVX512DQ-14] _ = x[AVX512CD-14]
_ = x[AVX512ER-15] _ = x[AVX512DQ-15]
_ = x[AVX512F-16] _ = x[AVX512ER-16]
_ = x[AVX512FP16-17] _ = x[AVX512F-17]
_ = x[AVX512IFMA-18] _ = x[AVX512FP16-18]
_ = x[AVX512PF-19] _ = x[AVX512IFMA-19]
_ = x[AVX512VBMI-20] _ = x[AVX512PF-20]
_ = x[AVX512VBMI2-21] _ = x[AVX512VBMI-21]
_ = x[AVX512VL-22] _ = x[AVX512VBMI2-22]
_ = x[AVX512VNNI-23] _ = x[AVX512VL-23]
_ = x[AVX512VP2INTERSECT-24] _ = x[AVX512VNNI-24]
_ = x[AVX512VPOPCNTDQ-25] _ = x[AVX512VP2INTERSECT-25]
_ = x[AVXSLOW-26] _ = x[AVX512VPOPCNTDQ-26]
_ = x[AVXVNNI-27] _ = x[AVXIFMA-27]
_ = x[BMI1-28] _ = x[AVXNECONVERT-28]
_ = x[BMI2-29] _ = x[AVXSLOW-29]
_ = x[CETIBT-30] _ = x[AVXVNNI-30]
_ = x[CETSS-31] _ = x[AVXVNNIINT8-31]
_ = x[CLDEMOTE-32] _ = x[BMI1-32]
_ = x[CLMUL-33] _ = x[BMI2-33]
_ = x[CLZERO-34] _ = x[CETIBT-34]
_ = x[CMOV-35] _ = x[CETSS-35]
_ = x[CMPSB_SCADBS_SHORT-36] _ = x[CLDEMOTE-36]
_ = x[CMPXCHG8-37] _ = x[CLMUL-37]
_ = x[CPBOOST-38] _ = x[CLZERO-38]
_ = x[CX16-39] _ = x[CMOV-39]
_ = x[ENQCMD-40] _ = x[CMPCCXADD-40]
_ = x[ERMS-41] _ = x[CMPSB_SCADBS_SHORT-41]
_ = x[F16C-42] _ = x[CMPXCHG8-42]
_ = x[FLUSH_L1D-43] _ = x[CPBOOST-43]
_ = x[FMA3-44] _ = x[CPPC-44]
_ = x[FMA4-45] _ = x[CX16-45]
_ = x[FSRM-46] _ = x[EFER_LMSLE_UNS-46]
_ = x[FXSR-47] _ = x[ENQCMD-47]
_ = x[FXSROPT-48] _ = x[ERMS-48]
_ = x[GFNI-49] _ = x[F16C-49]
_ = x[HLE-50] _ = x[FLUSH_L1D-50]
_ = x[HRESET-51] _ = x[FMA3-51]
_ = x[HTT-52] _ = x[FMA4-52]
_ = x[HWA-53] _ = x[FP128-53]
_ = x[HYBRID_CPU-54] _ = x[FP256-54]
_ = x[HYPERVISOR-55] _ = x[FSRM-55]
_ = x[IA32_ARCH_CAP-56] _ = x[FXSR-56]
_ = x[IA32_CORE_CAP-57] _ = x[FXSROPT-57]
_ = x[IBPB-58] _ = x[GFNI-58]
_ = x[IBS-59] _ = x[HLE-59]
_ = x[IBSBRNTRGT-60] _ = x[HRESET-60]
_ = x[IBSFETCHSAM-61] _ = x[HTT-61]
_ = x[IBSFFV-62] _ = x[HWA-62]
_ = x[IBSOPCNT-63] _ = x[HYBRID_CPU-63]
_ = x[IBSOPCNTEXT-64] _ = x[HYPERVISOR-64]
_ = x[IBSOPSAM-65] _ = x[IA32_ARCH_CAP-65]
_ = x[IBSRDWROPCNT-66] _ = x[IA32_CORE_CAP-66]
_ = x[IBSRIPINVALIDCHK-67] _ = x[IBPB-67]
_ = x[IBS_PREVENTHOST-68] _ = x[IBRS-68]
_ = x[INT_WBINVD-69] _ = x[IBRS_PREFERRED-69]
_ = x[INVLPGB-70] _ = x[IBRS_PROVIDES_SMP-70]
_ = x[LAHF-71] _ = x[IBS-71]
_ = x[LAM-72] _ = x[IBSBRNTRGT-72]
_ = x[LBRVIRT-73] _ = x[IBSFETCHSAM-73]
_ = x[LZCNT-74] _ = x[IBSFFV-74]
_ = x[MCAOVERFLOW-75] _ = x[IBSOPCNT-75]
_ = x[MCDT_NO-76] _ = x[IBSOPCNTEXT-76]
_ = x[MCOMMIT-77] _ = x[IBSOPSAM-77]
_ = x[MD_CLEAR-78] _ = x[IBSRDWROPCNT-78]
_ = x[MMX-79] _ = x[IBSRIPINVALIDCHK-79]
_ = x[MMXEXT-80] _ = x[IBS_FETCH_CTLX-80]
_ = x[MOVBE-81] _ = x[IBS_OPDATA4-81]
_ = x[MOVDIR64B-82] _ = x[IBS_OPFUSE-82]
_ = x[MOVDIRI-83] _ = x[IBS_PREVENTHOST-83]
_ = x[MOVSB_ZL-84] _ = x[IBS_ZEN4-84]
_ = x[MPX-85] _ = x[INT_WBINVD-85]
_ = x[MSRIRC-86] _ = x[INVLPGB-86]
_ = x[MSR_PAGEFLUSH-87] _ = x[LAHF-87]
_ = x[NRIPS-88] _ = x[LAM-88]
_ = x[NX-89] _ = x[LBRVIRT-89]
_ = x[OSXSAVE-90] _ = x[LZCNT-90]
_ = x[PCONFIG-91] _ = x[MCAOVERFLOW-91]
_ = x[POPCNT-92] _ = x[MCDT_NO-92]
_ = x[RDPRU-93] _ = x[MCOMMIT-93]
_ = x[RDRAND-94] _ = x[MD_CLEAR-94]
_ = x[RDSEED-95] _ = x[MMX-95]
_ = x[RDTSCP-96] _ = x[MMXEXT-96]
_ = x[RTM-97] _ = x[MOVBE-97]
_ = x[RTM_ALWAYS_ABORT-98] _ = x[MOVDIR64B-98]
_ = x[SERIALIZE-99] _ = x[MOVDIRI-99]
_ = x[SEV-100] _ = x[MOVSB_ZL-100]
_ = x[SEV_64BIT-101] _ = x[MOVU-101]
_ = x[SEV_ALTERNATIVE-102] _ = x[MPX-102]
_ = x[SEV_DEBUGSWAP-103] _ = x[MSRIRC-103]
_ = x[SEV_ES-104] _ = x[MSR_PAGEFLUSH-104]
_ = x[SEV_RESTRICTED-105] _ = x[NRIPS-105]
_ = x[SEV_SNP-106] _ = x[NX-106]
_ = x[SGX-107] _ = x[OSXSAVE-107]
_ = x[SGXLC-108] _ = x[PCONFIG-108]
_ = x[SHA-109] _ = x[POPCNT-109]
_ = x[SME-110] _ = x[PPIN-110]
_ = x[SME_COHERENT-111] _ = x[PREFETCHI-111]
_ = x[SPEC_CTRL_SSBD-112] _ = x[PSFD-112]
_ = x[SRBDS_CTRL-113] _ = x[RDPRU-113]
_ = x[SSE-114] _ = x[RDRAND-114]
_ = x[SSE2-115] _ = x[RDSEED-115]
_ = x[SSE3-116] _ = x[RDTSCP-116]
_ = x[SSE4-117] _ = x[RTM-117]
_ = x[SSE42-118] _ = x[RTM_ALWAYS_ABORT-118]
_ = x[SSE4A-119] _ = x[SERIALIZE-119]
_ = x[SSSE3-120] _ = x[SEV-120]
_ = x[STIBP-121] _ = x[SEV_64BIT-121]
_ = x[STOSB_SHORT-122] _ = x[SEV_ALTERNATIVE-122]
_ = x[SUCCOR-123] _ = x[SEV_DEBUGSWAP-123]
_ = x[SVM-124] _ = x[SEV_ES-124]
_ = x[SVMDA-125] _ = x[SEV_RESTRICTED-125]
_ = x[SVMFBASID-126] _ = x[SEV_SNP-126]
_ = x[SVML-127] _ = x[SGX-127]
_ = x[SVMNP-128] _ = x[SGXLC-128]
_ = x[SVMPF-129] _ = x[SHA-129]
_ = x[SVMPFT-130] _ = x[SME-130]
_ = x[SYSCALL-131] _ = x[SME_COHERENT-131]
_ = x[SYSEE-132] _ = x[SPEC_CTRL_SSBD-132]
_ = x[TBM-133] _ = x[SRBDS_CTRL-133]
_ = x[TME-134] _ = x[SSE-134]
_ = x[TOPEXT-135] _ = x[SSE2-135]
_ = x[TSCRATEMSR-136] _ = x[SSE3-136]
_ = x[TSXLDTRK-137] _ = x[SSE4-137]
_ = x[VAES-138] _ = x[SSE42-138]
_ = x[VMCBCLEAN-139] _ = x[SSE4A-139]
_ = x[VMPL-140] _ = x[SSSE3-140]
_ = x[VMSA_REGPROT-141] _ = x[STIBP-141]
_ = x[VMX-142] _ = x[STIBP_ALWAYSON-142]
_ = x[VPCLMULQDQ-143] _ = x[STOSB_SHORT-143]
_ = x[VTE-144] _ = x[SUCCOR-144]
_ = x[WAITPKG-145] _ = x[SVM-145]
_ = x[WBNOINVD-146] _ = x[SVMDA-146]
_ = x[X87-147] _ = x[SVMFBASID-147]
_ = x[XGETBV1-148] _ = x[SVML-148]
_ = x[XOP-149] _ = x[SVMNP-149]
_ = x[XSAVE-150] _ = x[SVMPF-150]
_ = x[XSAVEC-151] _ = x[SVMPFT-151]
_ = x[XSAVEOPT-152] _ = x[SYSCALL-152]
_ = x[XSAVES-153] _ = x[SYSEE-153]
_ = x[AESARM-154] _ = x[TBM-154]
_ = x[ARMCPUID-155] _ = x[TLB_FLUSH_NESTED-155]
_ = x[ASIMD-156] _ = x[TME-156]
_ = x[ASIMDDP-157] _ = x[TOPEXT-157]
_ = x[ASIMDHP-158] _ = x[TSCRATEMSR-158]
_ = x[ASIMDRDM-159] _ = x[TSXLDTRK-159]
_ = x[ATOMICS-160] _ = x[VAES-160]
_ = x[CRC32-161] _ = x[VMCBCLEAN-161]
_ = x[DCPOP-162] _ = x[VMPL-162]
_ = x[EVTSTRM-163] _ = x[VMSA_REGPROT-163]
_ = x[FCMA-164] _ = x[VMX-164]
_ = x[FP-165] _ = x[VPCLMULQDQ-165]
_ = x[FPHP-166] _ = x[VTE-166]
_ = x[GPA-167] _ = x[WAITPKG-167]
_ = x[JSCVT-168] _ = x[WBNOINVD-168]
_ = x[LRCPC-169] _ = x[X87-169]
_ = x[PMULL-170] _ = x[XGETBV1-170]
_ = x[SHA1-171] _ = x[XOP-171]
_ = x[SHA2-172] _ = x[XSAVE-172]
_ = x[SHA3-173] _ = x[XSAVEC-173]
_ = x[SHA512-174] _ = x[XSAVEOPT-174]
_ = x[SM3-175] _ = x[XSAVES-175]
_ = x[SM4-176] _ = x[AESARM-176]
_ = x[SVE-177] _ = x[ARMCPUID-177]
_ = x[lastID-178] _ = x[ASIMD-178]
_ = x[ASIMDDP-179]
_ = x[ASIMDHP-180]
_ = x[ASIMDRDM-181]
_ = x[ATOMICS-182]
_ = x[CRC32-183]
_ = x[DCPOP-184]
_ = x[EVTSTRM-185]
_ = x[FCMA-186]
_ = x[FP-187]
_ = x[FPHP-188]
_ = x[GPA-189]
_ = x[JSCVT-190]
_ = x[LRCPC-191]
_ = x[PMULL-192]
_ = x[SHA1-193]
_ = x[SHA2-194]
_ = x[SHA3-195]
_ = x[SHA512-196]
_ = x[SM3-197]
_ = x[SM4-198]
_ = x[SVE-199]
_ = x[lastID-200]
_ = x[firstID-0] _ = x[firstID-0]
} }
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFLUSH_L1DFMA3FMA4FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4INT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 237, 241, 245, 251, 256, 264, 269, 275, 279, 297, 305, 312, 316, 322, 326, 330, 339, 343, 347, 351, 355, 362, 366, 369, 375, 378, 381, 391, 401, 414, 427, 431, 434, 444, 455, 461, 469, 480, 488, 500, 516, 531, 541, 548, 552, 555, 562, 567, 578, 585, 592, 600, 603, 609, 614, 623, 630, 638, 641, 647, 660, 665, 667, 674, 681, 687, 692, 698, 704, 710, 713, 729, 738, 741, 750, 765, 778, 784, 798, 805, 808, 813, 816, 819, 831, 845, 855, 858, 862, 866, 870, 875, 880, 885, 890, 901, 907, 910, 915, 924, 928, 933, 938, 944, 951, 956, 959, 962, 968, 978, 986, 990, 999, 1003, 1015, 1018, 1028, 1031, 1038, 1046, 1049, 1056, 1059, 1064, 1070, 1078, 1084, 1090, 1098, 1103, 1110, 1117, 1125, 1132, 1137, 1142, 1149, 1153, 1155, 1159, 1162, 1167, 1172, 1177, 1181, 1185, 1189, 1195, 1198, 1201, 1204, 1210} var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 278, 282, 288, 293, 301, 306, 312, 316, 325, 343, 351, 358, 362, 366, 380, 386, 390, 394, 403, 407, 411, 416, 421, 425, 429, 436, 440, 443, 449, 452, 455, 465, 475, 488, 501, 505, 509, 523, 540, 543, 553, 564, 570, 578, 589, 597, 609, 625, 639, 650, 660, 675, 683, 693, 700, 704, 707, 714, 719, 730, 737, 744, 752, 755, 761, 766, 775, 782, 790, 794, 797, 803, 816, 821, 823, 830, 837, 843, 847, 856, 860, 865, 871, 877, 883, 886, 902, 911, 914, 923, 938, 951, 957, 971, 978, 981, 986, 989, 992, 1004, 1018, 1028, 1031, 1035, 1039, 1043, 1048, 1053, 1058, 1063, 1077, 1088, 1094, 1097, 1102, 1111, 1115, 1120, 1125, 1131, 1138, 1143, 1146, 1162, 1165, 1171, 1181, 1189, 1193, 1202, 1206, 1218, 1221, 1231, 1234, 1241, 1249, 1252, 1259, 1262, 1267, 1273, 1281, 1287, 1293, 1301, 1306, 1313, 1320, 1328, 1335, 1340, 1345, 1352, 1356, 1358, 1362, 1365, 1370, 1375, 1380, 1384, 1388, 1392, 1398, 1401, 1404, 1407, 1413}
func (i FeatureID) String() string { func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

View file

@ -83,7 +83,7 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
c.Model = sysctlGetInt(0, "machdep.cpu.model") c.Model = sysctlGetInt(0, "machdep.cpu.model")
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1icachesize") c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")

View file

@ -1,5 +1,5 @@
//go:build (darwin || freebsd || openbsd || netbsd || dragonfly) && !appengine //go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine
// +build darwin freebsd openbsd netbsd dragonfly // +build darwin freebsd openbsd netbsd dragonfly hurd
// +build !appengine // +build !appengine
package isatty package isatty

View file

@ -16,6 +16,8 @@ lint:
vet: vet:
@GO111MODULE=on go vet ./... @GO111MODULE=on go vet ./...
@echo "Installing staticcheck" && go install honnef.co/go/tools/cmd/staticcheck@latest
${GOPATH}/bin/staticcheck -tests=false -checks="all,-ST1000,-ST1003,-ST1016,-ST1020,-ST1021,-ST1022,-ST1023,-ST1005"
test: test:
@GO111MODULE=on SERVER_ENDPOINT=localhost:9000 ACCESS_KEY=minio SECRET_KEY=minio123 ENABLE_HTTPS=1 MINT_MODE=full go test -race -v ./... @GO111MODULE=on SERVER_ENDPOINT=localhost:9000 ACCESS_KEY=minio SECRET_KEY=minio123 ENABLE_HTTPS=1 MINT_MODE=full go test -race -v ./...

View file

@ -21,7 +21,7 @@ import (
"bytes" "bytes"
"context" "context"
"encoding/xml" "encoding/xml"
"io/ioutil" "io"
"net/http" "net/http"
"net/url" "net/url"
@ -143,5 +143,5 @@ func (c *Client) getBucketLifecycle(ctx context.Context, bucketName string) ([]b
} }
} }
return ioutil.ReadAll(resp.Body) return io.ReadAll(resp.Body)
} }

View file

@ -18,7 +18,7 @@ package minio
import ( import (
"context" "context"
"io/ioutil" "io"
"net/http" "net/http"
"net/url" "net/url"
"strings" "strings"
@ -137,7 +137,7 @@ func (c *Client) getBucketPolicy(ctx context.Context, bucketName string) (string
} }
} }
bucketPolicyBuf, err := ioutil.ReadAll(resp.Body) bucketPolicyBuf, err := io.ReadAll(resp.Body)
if err != nil { if err != nil {
return "", err return "", err
} }

View file

@ -22,7 +22,7 @@ import (
"context" "context"
"encoding/json" "encoding/json"
"encoding/xml" "encoding/xml"
"io/ioutil" "io"
"net/http" "net/http"
"net/url" "net/url"
"time" "time"
@ -180,7 +180,7 @@ func (c *Client) GetBucketReplicationMetrics(ctx context.Context, bucketName str
if resp.StatusCode != http.StatusOK { if resp.StatusCode != http.StatusOK {
return s, httpRespToErrorResponse(resp, bucketName, "") return s, httpRespToErrorResponse(resp, bucketName, "")
} }
respBytes, err := ioutil.ReadAll(resp.Body) respBytes, err := io.ReadAll(resp.Body)
if err != nil { if err != nil {
return s, err return s, err
} }

View file

@ -22,7 +22,6 @@ import (
"encoding/xml" "encoding/xml"
"errors" "errors"
"io" "io"
"io/ioutil"
"net/http" "net/http"
"net/url" "net/url"
@ -58,7 +57,7 @@ func (c *Client) GetBucketTagging(ctx context.Context, bucketName string) (*tags
return nil, httpRespToErrorResponse(resp, bucketName, "") return nil, httpRespToErrorResponse(resp, bucketName, "")
} }
defer io.Copy(ioutil.Discard, resp.Body) defer io.Copy(io.Discard, resp.Body)
return tags.ParseBucketXML(resp.Body) return tags.ParseBucketXML(resp.Body)
} }

View file

@ -21,7 +21,6 @@ import (
"context" "context"
"fmt" "fmt"
"io" "io"
"io/ioutil"
"net/http" "net/http"
"net/url" "net/url"
"strconv" "strconv"
@ -221,7 +220,7 @@ func (c *Client) copyObjectDo(ctx context.Context, srcBucket, srcObject, destBuc
headers.Set(minIOBucketSourceETag, dstOpts.Internal.SourceETag) headers.Set(minIOBucketSourceETag, dstOpts.Internal.SourceETag)
} }
if dstOpts.Internal.ReplicationRequest { if dstOpts.Internal.ReplicationRequest {
headers.Set(minIOBucketReplicationRequest, "") headers.Set(minIOBucketReplicationRequest, "true")
} }
if !dstOpts.Internal.LegalholdTimestamp.IsZero() { if !dstOpts.Internal.LegalholdTimestamp.IsZero() {
headers.Set(minIOBucketReplicationObjectLegalHoldTimestamp, dstOpts.Internal.LegalholdTimestamp.Format(time.RFC3339Nano)) headers.Set(minIOBucketReplicationObjectLegalHoldTimestamp, dstOpts.Internal.LegalholdTimestamp.Format(time.RFC3339Nano))
@ -516,7 +515,7 @@ func (c *Client) ComposeObject(ctx context.Context, dst CopyDestOptions, srcs ..
return UploadInfo{}, err return UploadInfo{}, err
} }
if dst.Progress != nil { if dst.Progress != nil {
io.CopyN(ioutil.Discard, dst.Progress, end-start+1) io.CopyN(io.Discard, dst.Progress, end-start+1)
} }
objParts = append(objParts, complPart) objParts = append(objParts, complPart)
partIndex++ partIndex++
@ -525,7 +524,7 @@ func (c *Client) ComposeObject(ctx context.Context, dst CopyDestOptions, srcs ..
// 4. Make final complete-multipart request. // 4. Make final complete-multipart request.
uploadInfo, err := c.completeMultipartUpload(ctx, dst.Bucket, dst.Object, uploadID, uploadInfo, err := c.completeMultipartUpload(ctx, dst.Bucket, dst.Object, uploadID,
completeMultipartUpload{Parts: objParts}, PutObjectOptions{}) completeMultipartUpload{Parts: objParts}, PutObjectOptions{ServerSideEncryption: dst.Encryption})
if err != nil { if err != nil {
return UploadInfo{}, err return UploadInfo{}, err
} }

View file

@ -20,7 +20,6 @@ package minio
import ( import (
"context" "context"
"io" "io"
"io/ioutil"
"net/http" "net/http"
) )
@ -54,7 +53,7 @@ func (c *Client) CopyObject(ctx context.Context, dst CopyDestOptions, src CopySr
// Update the progress properly after successful copy. // Update the progress properly after successful copy.
if dst.Progress != nil { if dst.Progress != nil {
io.Copy(ioutil.Discard, io.LimitReader(dst.Progress, dst.Size)) io.Copy(io.Discard, io.LimitReader(dst.Progress, dst.Size))
} }
cpObjRes := copyObjectResult{} cpObjRes := copyObjectResult{}

View file

@ -87,6 +87,8 @@ type UploadInfo struct {
ExpirationRuleID string ExpirationRuleID string
// Verified checksum values, if any. // Verified checksum values, if any.
// Values are base64 (standard) encoded.
// For multipart objects this is a checksum of the checksum of each part.
ChecksumCRC32 string ChecksumCRC32 string
ChecksumCRC32C string ChecksumCRC32C string
ChecksumSHA1 string ChecksumSHA1 string
@ -147,7 +149,8 @@ type ObjectInfo struct {
// - FAILED // - FAILED
// - REPLICA (on the destination) // - REPLICA (on the destination)
ReplicationStatus string `xml:"ReplicationStatus"` ReplicationStatus string `xml:"ReplicationStatus"`
// set to true if delete marker has backing object version on target, and eligible to replicate
ReplicationReady bool
// Lifecycle expiry-date and ruleID associated with the expiry // Lifecycle expiry-date and ruleID associated with the expiry
// not to be confused with `Expires` HTTP header. // not to be confused with `Expires` HTTP header.
Expiration time.Time Expiration time.Time

View file

@ -22,7 +22,6 @@ import (
"encoding/xml" "encoding/xml"
"fmt" "fmt"
"io" "io"
"io/ioutil"
"net/http" "net/http"
) )
@ -108,7 +107,7 @@ const (
func xmlDecodeAndBody(bodyReader io.Reader, v interface{}) ([]byte, error) { func xmlDecodeAndBody(bodyReader io.Reader, v interface{}) ([]byte, error) {
// read the whole body (up to 1MB) // read the whole body (up to 1MB)
const maxBodyLength = 1 << 20 const maxBodyLength = 1 << 20
body, err := ioutil.ReadAll(io.LimitReader(bodyReader, maxBodyLength)) body, err := io.ReadAll(io.LimitReader(bodyReader, maxBodyLength))
if err != nil { if err != nil {
return nil, err return nil, err
} }
@ -253,26 +252,6 @@ func errUnexpectedEOF(totalRead, totalSize int64, bucketName, objectName string)
} }
} }
// errInvalidBucketName - Invalid bucket name response.
func errInvalidBucketName(message string) error {
return ErrorResponse{
StatusCode: http.StatusBadRequest,
Code: "InvalidBucketName",
Message: message,
RequestID: "minio",
}
}
// errInvalidObjectName - Invalid object name response.
func errInvalidObjectName(message string) error {
return ErrorResponse{
StatusCode: http.StatusNotFound,
Code: "NoSuchKey",
Message: message,
RequestID: "minio",
}
}
// errInvalidArgument - Invalid argument response. // errInvalidArgument - Invalid argument response.
func errInvalidArgument(message string) error { func errInvalidArgument(message string) error {
return ErrorResponse{ return ErrorResponse{

View file

@ -28,6 +28,7 @@ import (
// AdvancedGetOptions for internal use by MinIO server - not intended for client use. // AdvancedGetOptions for internal use by MinIO server - not intended for client use.
type AdvancedGetOptions struct { type AdvancedGetOptions struct {
ReplicationDeleteMarker bool ReplicationDeleteMarker bool
IsReplicationReadyForDeleteMarker bool
ReplicationProxyRequest string ReplicationProxyRequest string
} }

View file

@ -70,21 +70,28 @@ func (c *Client) listObjectsV2(ctx context.Context, bucketName string, opts List
// Return object owner information by default // Return object owner information by default
fetchOwner := true fetchOwner := true
sendObjectInfo := func(info ObjectInfo) {
select {
case objectStatCh <- info:
case <-ctx.Done():
}
}
// Validate bucket name. // Validate bucket name.
if err := s3utils.CheckValidBucketName(bucketName); err != nil { if err := s3utils.CheckValidBucketName(bucketName); err != nil {
defer close(objectStatCh) defer close(objectStatCh)
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return objectStatCh return objectStatCh
} }
// Validate incoming object prefix. // Validate incoming object prefix.
if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil { if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil {
defer close(objectStatCh) defer close(objectStatCh)
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return objectStatCh return objectStatCh
} }
@ -98,9 +105,9 @@ func (c *Client) listObjectsV2(ctx context.Context, bucketName string, opts List
result, err := c.listObjectsV2Query(ctx, bucketName, opts.Prefix, continuationToken, result, err := c.listObjectsV2Query(ctx, bucketName, opts.Prefix, continuationToken,
fetchOwner, opts.WithMetadata, delimiter, opts.StartAfter, opts.MaxKeys, opts.headers) fetchOwner, opts.WithMetadata, delimiter, opts.StartAfter, opts.MaxKeys, opts.headers)
if err != nil { if err != nil {
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return return
} }
@ -137,6 +144,14 @@ func (c *Client) listObjectsV2(ctx context.Context, bucketName string, opts List
if !result.IsTruncated { if !result.IsTruncated {
return return
} }
// Add this to catch broken S3 API implementations.
if continuationToken == "" {
sendObjectInfo(ObjectInfo{
Err: fmt.Errorf("listObjectsV2 is truncated without continuationToken, %s S3 server is incompatible with S3 API", c.endpointURL),
})
return
}
} }
}(objectStatCh) }(objectStatCh)
return objectStatCh return objectStatCh
@ -262,20 +277,28 @@ func (c *Client) listObjects(ctx context.Context, bucketName string, opts ListOb
// If recursive we do not delimit. // If recursive we do not delimit.
delimiter = "" delimiter = ""
} }
sendObjectInfo := func(info ObjectInfo) {
select {
case objectStatCh <- info:
case <-ctx.Done():
}
}
// Validate bucket name. // Validate bucket name.
if err := s3utils.CheckValidBucketName(bucketName); err != nil { if err := s3utils.CheckValidBucketName(bucketName); err != nil {
defer close(objectStatCh) defer close(objectStatCh)
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return objectStatCh return objectStatCh
} }
// Validate incoming object prefix. // Validate incoming object prefix.
if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil { if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil {
defer close(objectStatCh) defer close(objectStatCh)
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return objectStatCh return objectStatCh
} }
@ -288,9 +311,9 @@ func (c *Client) listObjects(ctx context.Context, bucketName string, opts ListOb
// Get list of objects a maximum of 1000 per request. // Get list of objects a maximum of 1000 per request.
result, err := c.listObjectsQuery(ctx, bucketName, opts.Prefix, marker, delimiter, opts.MaxKeys, opts.headers) result, err := c.listObjectsQuery(ctx, bucketName, opts.Prefix, marker, delimiter, opts.MaxKeys, opts.headers)
if err != nil { if err != nil {
objectStatCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return return
} }
@ -343,21 +366,28 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts
delimiter = "" delimiter = ""
} }
sendObjectInfo := func(info ObjectInfo) {
select {
case resultCh <- info:
case <-ctx.Done():
}
}
// Validate bucket name. // Validate bucket name.
if err := s3utils.CheckValidBucketName(bucketName); err != nil { if err := s3utils.CheckValidBucketName(bucketName); err != nil {
defer close(resultCh) defer close(resultCh)
resultCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return resultCh return resultCh
} }
// Validate incoming object prefix. // Validate incoming object prefix.
if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil { if err := s3utils.CheckValidObjectNamePrefix(opts.Prefix); err != nil {
defer close(resultCh) defer close(resultCh)
resultCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return resultCh return resultCh
} }
@ -374,9 +404,9 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts
// Get list of objects a maximum of 1000 per request. // Get list of objects a maximum of 1000 per request.
result, err := c.listObjectVersionsQuery(ctx, bucketName, opts.Prefix, keyMarker, versionIDMarker, delimiter, opts.MaxKeys, opts.headers) result, err := c.listObjectVersionsQuery(ctx, bucketName, opts.Prefix, keyMarker, versionIDMarker, delimiter, opts.MaxKeys, opts.headers)
if err != nil { if err != nil {
resultCh <- ObjectInfo{ sendObjectInfo(ObjectInfo{
Err: err, Err: err,
} })
return return
} }
@ -867,6 +897,8 @@ func (c *Client) listMultipartUploadsQuery(ctx context.Context, bucketName, keyM
} }
// listObjectParts list all object parts recursively. // listObjectParts list all object parts recursively.
//
//lint:ignore U1000 Keep this around
func (c *Client) listObjectParts(ctx context.Context, bucketName, objectName, uploadID string) (partsInfo map[int]ObjectPart, err error) { func (c *Client) listObjectParts(ctx context.Context, bucketName, objectName, uploadID string) (partsInfo map[int]ObjectPart, err error) {
// Part number marker for the next batch of request. // Part number marker for the next batch of request.
var nextPartNumberMarker int var nextPartNumberMarker int

View file

@ -26,7 +26,6 @@ import (
"fmt" "fmt"
"hash/crc32" "hash/crc32"
"io" "io"
"io/ioutil"
"net/http" "net/http"
"net/url" "net/url"
"sort" "sort"
@ -159,8 +158,9 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
crcBytes = append(crcBytes, cSum...) crcBytes = append(crcBytes, cSum...)
} }
p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: rd, partNumber: partNumber, md5Base64: md5Base64, sha256Hex: sha256Hex, size: int64(length), sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader}
// Proceed to upload the part. // Proceed to upload the part.
objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, rd, partNumber, md5Base64, sha256Hex, int64(length), opts.ServerSideEncryption, !opts.DisableContentSha256, customHeader) objPart, uerr := c.uploadPart(ctx, p)
if uerr != nil { if uerr != nil {
return UploadInfo{}, uerr return UploadInfo{}, uerr
} }
@ -200,7 +200,9 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
// Sort all completed parts. // Sort all completed parts.
sort.Sort(completedParts(complMultipartUpload.Parts)) sort.Sort(completedParts(complMultipartUpload.Parts))
opts = PutObjectOptions{} opts = PutObjectOptions{
ServerSideEncryption: opts.ServerSideEncryption,
}
if len(crcBytes) > 0 { if len(crcBytes) > 0 {
// Add hash of hashes. // Add hash of hashes.
crc.Reset() crc.Reset()
@ -269,57 +271,73 @@ func (c *Client) initiateMultipartUpload(ctx context.Context, bucketName, object
return initiateMultipartUploadResult, nil return initiateMultipartUploadResult, nil
} }
type uploadPartParams struct {
bucketName string
objectName string
uploadID string
reader io.Reader
partNumber int
md5Base64 string
sha256Hex string
size int64
sse encrypt.ServerSide
streamSha256 bool
customHeader http.Header
trailer http.Header
}
// uploadPart - Uploads a part in a multipart upload. // uploadPart - Uploads a part in a multipart upload.
func (c *Client) uploadPart(ctx context.Context, bucketName string, objectName string, uploadID string, reader io.Reader, partNumber int, md5Base64 string, sha256Hex string, size int64, sse encrypt.ServerSide, streamSha256 bool, customHeader http.Header) (ObjectPart, error) { func (c *Client) uploadPart(ctx context.Context, p uploadPartParams) (ObjectPart, error) {
// Input validation. // Input validation.
if err := s3utils.CheckValidBucketName(bucketName); err != nil { if err := s3utils.CheckValidBucketName(p.bucketName); err != nil {
return ObjectPart{}, err return ObjectPart{}, err
} }
if err := s3utils.CheckValidObjectName(objectName); err != nil { if err := s3utils.CheckValidObjectName(p.objectName); err != nil {
return ObjectPart{}, err return ObjectPart{}, err
} }
if size > maxPartSize { if p.size > maxPartSize {
return ObjectPart{}, errEntityTooLarge(size, maxPartSize, bucketName, objectName) return ObjectPart{}, errEntityTooLarge(p.size, maxPartSize, p.bucketName, p.objectName)
} }
if size <= -1 { if p.size <= -1 {
return ObjectPart{}, errEntityTooSmall(size, bucketName, objectName) return ObjectPart{}, errEntityTooSmall(p.size, p.bucketName, p.objectName)
} }
if partNumber <= 0 { if p.partNumber <= 0 {
return ObjectPart{}, errInvalidArgument("Part number cannot be negative or equal to zero.") return ObjectPart{}, errInvalidArgument("Part number cannot be negative or equal to zero.")
} }
if uploadID == "" { if p.uploadID == "" {
return ObjectPart{}, errInvalidArgument("UploadID cannot be empty.") return ObjectPart{}, errInvalidArgument("UploadID cannot be empty.")
} }
// Get resources properly escaped and lined up before using them in http request. // Get resources properly escaped and lined up before using them in http request.
urlValues := make(url.Values) urlValues := make(url.Values)
// Set part number. // Set part number.
urlValues.Set("partNumber", strconv.Itoa(partNumber)) urlValues.Set("partNumber", strconv.Itoa(p.partNumber))
// Set upload id. // Set upload id.
urlValues.Set("uploadId", uploadID) urlValues.Set("uploadId", p.uploadID)
// Set encryption headers, if any. // Set encryption headers, if any.
if customHeader == nil { if p.customHeader == nil {
customHeader = make(http.Header) p.customHeader = make(http.Header)
} }
// https://docs.aws.amazon.com/AmazonS3/latest/API/mpUploadUploadPart.html // https://docs.aws.amazon.com/AmazonS3/latest/API/mpUploadUploadPart.html
// Server-side encryption is supported by the S3 Multipart Upload actions. // Server-side encryption is supported by the S3 Multipart Upload actions.
// Unless you are using a customer-provided encryption key, you don't need // Unless you are using a customer-provided encryption key, you don't need
// to specify the encryption parameters in each UploadPart request. // to specify the encryption parameters in each UploadPart request.
if sse != nil && sse.Type() == encrypt.SSEC { if p.sse != nil && p.sse.Type() == encrypt.SSEC {
sse.Marshal(customHeader) p.sse.Marshal(p.customHeader)
} }
reqMetadata := requestMetadata{ reqMetadata := requestMetadata{
bucketName: bucketName, bucketName: p.bucketName,
objectName: objectName, objectName: p.objectName,
queryValues: urlValues, queryValues: urlValues,
customHeader: customHeader, customHeader: p.customHeader,
contentBody: reader, contentBody: p.reader,
contentLength: size, contentLength: p.size,
contentMD5Base64: md5Base64, contentMD5Base64: p.md5Base64,
contentSHA256Hex: sha256Hex, contentSHA256Hex: p.sha256Hex,
streamSha256: streamSha256, streamSha256: p.streamSha256,
trailer: p.trailer,
} }
// Execute PUT on each part. // Execute PUT on each part.
@ -330,7 +348,7 @@ func (c *Client) uploadPart(ctx context.Context, bucketName string, objectName s
} }
if resp != nil { if resp != nil {
if resp.StatusCode != http.StatusOK { if resp.StatusCode != http.StatusOK {
return ObjectPart{}, httpRespToErrorResponse(resp, bucketName, objectName) return ObjectPart{}, httpRespToErrorResponse(resp, p.bucketName, p.objectName)
} }
} }
// Once successfully uploaded, return completed part. // Once successfully uploaded, return completed part.
@ -341,8 +359,8 @@ func (c *Client) uploadPart(ctx context.Context, bucketName string, objectName s
ChecksumSHA1: h.Get("x-amz-checksum-sha1"), ChecksumSHA1: h.Get("x-amz-checksum-sha1"),
ChecksumSHA256: h.Get("x-amz-checksum-sha256"), ChecksumSHA256: h.Get("x-amz-checksum-sha256"),
} }
objPart.Size = size objPart.Size = p.size
objPart.PartNumber = partNumber objPart.PartNumber = p.partNumber
// Trim off the odd double quotes from ETag in the beginning and end. // Trim off the odd double quotes from ETag in the beginning and end.
objPart.ETag = trimEtag(h.Get("ETag")) objPart.ETag = trimEtag(h.Get("ETag"))
return objPart, nil return objPart, nil
@ -395,7 +413,7 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object
// Read resp.Body into a []bytes to parse for Error response inside the body // Read resp.Body into a []bytes to parse for Error response inside the body
var b []byte var b []byte
b, err = ioutil.ReadAll(resp.Body) b, err = io.ReadAll(resp.Body)
if err != nil { if err != nil {
return UploadInfo{}, err return UploadInfo{}, err
} }
@ -431,5 +449,10 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object
Location: completeMultipartUploadResult.Location, Location: completeMultipartUploadResult.Location,
Expiration: expTime, Expiration: expTime,
ExpirationRuleID: ruleID, ExpirationRuleID: ruleID,
ChecksumSHA256: completeMultipartUploadResult.ChecksumSHA256,
ChecksumSHA1: completeMultipartUploadResult.ChecksumSHA1,
ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32,
ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C,
}, nil }, nil
} }

View file

@ -28,6 +28,7 @@ import (
"net/url" "net/url"
"sort" "sort"
"strings" "strings"
"sync"
"github.com/google/uuid" "github.com/google/uuid"
"github.com/minio/minio-go/v7/pkg/s3utils" "github.com/minio/minio-go/v7/pkg/s3utils"
@ -44,7 +45,9 @@ import (
func (c *Client) putObjectMultipartStream(ctx context.Context, bucketName, objectName string, func (c *Client) putObjectMultipartStream(ctx context.Context, bucketName, objectName string,
reader io.Reader, size int64, opts PutObjectOptions, reader io.Reader, size int64, opts PutObjectOptions,
) (info UploadInfo, err error) { ) (info UploadInfo, err error) {
if !isObject(reader) && isReadAt(reader) && !opts.SendContentMd5 { if opts.ConcurrentStreamParts && opts.NumThreads > 1 {
info, err = c.putObjectMultipartStreamParallel(ctx, bucketName, objectName, reader, opts)
} else if !isObject(reader) && isReadAt(reader) && !opts.SendContentMd5 {
// Verify if the reader implements ReadAt and it is not a *minio.Object then we will use parallel uploader. // Verify if the reader implements ReadAt and it is not a *minio.Object then we will use parallel uploader.
info, err = c.putObjectMultipartStreamFromReadAt(ctx, bucketName, objectName, reader.(io.ReaderAt), size, opts) info, err = c.putObjectMultipartStreamFromReadAt(ctx, bucketName, objectName, reader.(io.ReaderAt), size, opts)
} else { } else {
@ -107,11 +110,19 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
return UploadInfo{}, err return UploadInfo{}, err
} }
withChecksum := c.trailingHeaderSupport
if withChecksum {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = "CRC32C"
}
// Initiate a new multipart upload. // Initiate a new multipart upload.
uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts) uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
if err != nil { if err != nil {
return UploadInfo{}, err return UploadInfo{}, err
} }
delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
// Aborts the multipart upload in progress, if the // Aborts the multipart upload in progress, if the
// function returns any error, since we do not resume // function returns any error, since we do not resume
@ -177,14 +188,33 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
// As a special case if partNumber is lastPartNumber, we // As a special case if partNumber is lastPartNumber, we
// calculate the offset based on the last part size. // calculate the offset based on the last part size.
if uploadReq.PartNum == lastPartNumber { if uploadReq.PartNum == lastPartNumber {
readOffset = (size - lastPartSize) readOffset = size - lastPartSize
partSize = lastPartSize partSize = lastPartSize
} }
sectionReader := newHook(io.NewSectionReader(reader, readOffset, partSize), opts.Progress) sectionReader := newHook(io.NewSectionReader(reader, readOffset, partSize), opts.Progress)
var trailer = make(http.Header, 1)
if withChecksum {
crc := crc32.New(crc32.MakeTable(crc32.Castagnoli))
trailer.Set("x-amz-checksum-crc32c", base64.StdEncoding.EncodeToString(crc.Sum(nil)))
sectionReader = newHashReaderWrapper(sectionReader, crc, func(hash []byte) {
trailer.Set("x-amz-checksum-crc32c", base64.StdEncoding.EncodeToString(hash))
})
}
// Proceed to upload the part. // Proceed to upload the part.
objPart, err := c.uploadPart(ctx, bucketName, objectName, uploadID, sectionReader, uploadReq.PartNum, "", "", partSize, opts.ServerSideEncryption, !opts.DisableContentSha256, nil) p := uploadPartParams{bucketName: bucketName,
objectName: objectName,
uploadID: uploadID,
reader: sectionReader,
partNumber: uploadReq.PartNum,
size: partSize,
sse: opts.ServerSideEncryption,
streamSha256: !opts.DisableContentSha256,
sha256Hex: "",
trailer: trailer,
}
objPart, err := c.uploadPart(ctx, p)
if err != nil { if err != nil {
uploadedPartsCh <- uploadedPartRes{ uploadedPartsCh <- uploadedPartRes{
Error: err, Error: err,
@ -223,6 +253,10 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: uploadRes.Part.ETag, ETag: uploadRes.Part.ETag,
PartNumber: uploadRes.Part.PartNumber, PartNumber: uploadRes.Part.PartNumber,
ChecksumCRC32: uploadRes.Part.ChecksumCRC32,
ChecksumCRC32C: uploadRes.Part.ChecksumCRC32C,
ChecksumSHA1: uploadRes.Part.ChecksumSHA1,
ChecksumSHA256: uploadRes.Part.ChecksumSHA256,
}) })
} }
} }
@ -235,7 +269,22 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
// Sort all completed parts. // Sort all completed parts.
sort.Sort(completedParts(complMultipartUpload.Parts)) sort.Sort(completedParts(complMultipartUpload.Parts))
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, PutObjectOptions{}) opts = PutObjectOptions{
ServerSideEncryption: opts.ServerSideEncryption,
}
if withChecksum {
// Add hash of hashes.
crc := crc32.New(crc32.MakeTable(crc32.Castagnoli))
for _, part := range complMultipartUpload.Parts {
cs, err := base64.StdEncoding.DecodeString(part.ChecksumCRC32C)
if err == nil {
crc.Write(cs)
}
}
opts.UserMetadata = map[string]string{"X-Amz-Checksum-Crc32c": base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil { if err != nil {
return UploadInfo{}, err return UploadInfo{}, err
} }
@ -339,8 +388,8 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
// Update progress reader appropriately to the latest offset // Update progress reader appropriately to the latest offset
// as we read from the source. // as we read from the source.
hooked := newHook(bytes.NewReader(buf[:length]), opts.Progress) hooked := newHook(bytes.NewReader(buf[:length]), opts.Progress)
p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: hooked, partNumber: partNumber, md5Base64: md5Base64, size: partSize, sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader}
objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, hooked, partNumber, md5Base64, "", partSize, opts.ServerSideEncryption, !opts.DisableContentSha256, customHeader) objPart, uerr := c.uploadPart(ctx, p)
if uerr != nil { if uerr != nil {
return UploadInfo{}, uerr return UploadInfo{}, uerr
} }
@ -382,6 +431,211 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
// Sort all completed parts. // Sort all completed parts.
sort.Sort(completedParts(complMultipartUpload.Parts)) sort.Sort(completedParts(complMultipartUpload.Parts))
opts = PutObjectOptions{
ServerSideEncryption: opts.ServerSideEncryption,
}
if len(crcBytes) > 0 {
// Add hash of hashes.
crc.Reset()
crc.Write(crcBytes)
opts.UserMetadata = map[string]string{"X-Amz-Checksum-Crc32c": base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil {
return UploadInfo{}, err
}
uploadInfo.Size = totalUploadedSize
return uploadInfo, nil
}
// putObjectMultipartStreamParallel uploads opts.NumThreads parts in parallel.
// This is expected to take opts.PartSize * opts.NumThreads * (GOGC / 100) bytes of buffer.
func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketName, objectName string,
reader io.Reader, opts PutObjectOptions) (info UploadInfo, err error) {
// Input validation.
if err = s3utils.CheckValidBucketName(bucketName); err != nil {
return UploadInfo{}, err
}
if err = s3utils.CheckValidObjectName(objectName); err != nil {
return UploadInfo{}, err
}
if !opts.SendContentMd5 {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = "CRC32C"
}
// Cancel all when an error occurs.
ctx, cancel := context.WithCancel(ctx)
defer cancel()
// Calculate the optimal parts info for a given size.
totalPartsCount, partSize, _, err := OptimalPartInfo(-1, opts.PartSize)
if err != nil {
return UploadInfo{}, err
}
// Initiates a new multipart request
uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
if err != nil {
return UploadInfo{}, err
}
delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
// Aborts the multipart upload if the function returns
// any error, since we do not resume we should purge
// the parts which have been uploaded to relinquish
// storage space.
defer func() {
if err != nil {
c.abortMultipartUpload(ctx, bucketName, objectName, uploadID)
}
}()
// Create checksums
// CRC32C is ~50% faster on AMD64 @ 30GB/s
var crcBytes []byte
crc := crc32.New(crc32.MakeTable(crc32.Castagnoli))
md5Hash := c.md5Hasher()
defer md5Hash.Close()
// Total data read and written to server. should be equal to 'size' at the end of the call.
var totalUploadedSize int64
// Initialize parts uploaded map.
partsInfo := make(map[int]ObjectPart)
// Create a buffer.
nBuffers := int64(opts.NumThreads)
bufs := make(chan []byte, nBuffers)
all := make([]byte, nBuffers*partSize)
for i := int64(0); i < nBuffers; i++ {
bufs <- all[i*partSize : i*partSize+partSize]
}
var wg sync.WaitGroup
var mu sync.Mutex
errCh := make(chan error, opts.NumThreads)
reader = newHook(reader, opts.Progress)
// Part number always starts with '1'.
var partNumber int
for partNumber = 1; partNumber <= totalPartsCount; partNumber++ {
// Proceed to upload the part.
var buf []byte
select {
case buf = <-bufs:
case err = <-errCh:
cancel()
wg.Wait()
return UploadInfo{}, err
}
if int64(len(buf)) != partSize {
return UploadInfo{}, fmt.Errorf("read buffer < %d than expected partSize: %d", len(buf), partSize)
}
length, rerr := readFull(reader, buf)
if rerr == io.EOF && partNumber > 1 {
// Done
break
}
if rerr != nil && rerr != io.ErrUnexpectedEOF && err != io.EOF {
cancel()
wg.Wait()
return UploadInfo{}, rerr
}
// Calculate md5sum.
customHeader := make(http.Header)
if !opts.SendContentMd5 {
// Add CRC32C instead.
crc.Reset()
crc.Write(buf[:length])
cSum := crc.Sum(nil)
customHeader.Set("x-amz-checksum-crc32c", base64.StdEncoding.EncodeToString(cSum))
crcBytes = append(crcBytes, cSum...)
}
wg.Add(1)
go func(partNumber int) {
// Avoid declaring variables in the for loop
var md5Base64 string
if opts.SendContentMd5 {
md5Hash.Reset()
md5Hash.Write(buf[:length])
md5Base64 = base64.StdEncoding.EncodeToString(md5Hash.Sum(nil))
}
defer wg.Done()
p := uploadPartParams{
bucketName: bucketName,
objectName: objectName,
uploadID: uploadID,
reader: bytes.NewReader(buf[:length]),
partNumber: partNumber,
md5Base64: md5Base64,
size: int64(length),
sse: opts.ServerSideEncryption,
streamSha256: !opts.DisableContentSha256,
customHeader: customHeader,
}
objPart, uerr := c.uploadPart(ctx, p)
if uerr != nil {
errCh <- uerr
}
// Save successfully uploaded part metadata.
mu.Lock()
partsInfo[partNumber] = objPart
mu.Unlock()
// Send buffer back so it can be reused.
bufs <- buf
}(partNumber)
// Save successfully uploaded size.
totalUploadedSize += int64(length)
}
wg.Wait()
// Collect any error
select {
case err = <-errCh:
return UploadInfo{}, err
default:
}
// Complete multipart upload.
var complMultipartUpload completeMultipartUpload
// Loop over total uploaded parts to save them in
// Parts array before completing the multipart request.
for i := 1; i < partNumber; i++ {
part, ok := partsInfo[i]
if !ok {
return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i))
}
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
})
}
// Sort all completed parts.
sort.Sort(completedParts(complMultipartUpload.Parts))
opts = PutObjectOptions{} opts = PutObjectOptions{}
if len(crcBytes) > 0 { if len(crcBytes) > 0 {
// Add hash of hashes. // Add hash of hashes.

View file

@ -87,6 +87,11 @@ type PutObjectOptions struct {
SendContentMd5 bool SendContentMd5 bool
DisableContentSha256 bool DisableContentSha256 bool
DisableMultipart bool DisableMultipart bool
// ConcurrentStreamParts will create NumThreads buffers of PartSize bytes,
// fill them serially and upload them in parallel.
// This can be used for faster uploads on non-seekable or slow-to-seek input.
ConcurrentStreamParts bool
Internal AdvancedPutOptions Internal AdvancedPutOptions
} }
@ -159,7 +164,7 @@ func (opts PutObjectOptions) Header() (header http.Header) {
header.Set(minIOBucketSourceETag, opts.Internal.SourceETag) header.Set(minIOBucketSourceETag, opts.Internal.SourceETag)
} }
if opts.Internal.ReplicationRequest { if opts.Internal.ReplicationRequest {
header.Set(minIOBucketReplicationRequest, "") header.Set(minIOBucketReplicationRequest, "true")
} }
if !opts.Internal.LegalholdTimestamp.IsZero() { if !opts.Internal.LegalholdTimestamp.IsZero() {
header.Set(minIOBucketReplicationObjectLegalHoldTimestamp, opts.Internal.LegalholdTimestamp.Format(time.RFC3339Nano)) header.Set(minIOBucketReplicationObjectLegalHoldTimestamp, opts.Internal.LegalholdTimestamp.Format(time.RFC3339Nano))
@ -269,6 +274,12 @@ func (c *Client) putObjectCommon(ctx context.Context, bucketName, objectName str
} }
if size < 0 { if size < 0 {
if opts.DisableMultipart {
return UploadInfo{}, errors.New("no length provided and multipart disabled")
}
if opts.ConcurrentStreamParts && opts.NumThreads > 1 {
return c.putObjectMultipartStreamParallel(ctx, bucketName, objectName, reader, opts)
}
return c.putObjectMultipartStreamNoLength(ctx, bucketName, objectName, reader, opts) return c.putObjectMultipartStreamNoLength(ctx, bucketName, objectName, reader, opts)
} }
@ -366,7 +377,8 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
rd := newHook(bytes.NewReader(buf[:length]), opts.Progress) rd := newHook(bytes.NewReader(buf[:length]), opts.Progress)
// Proceed to upload the part. // Proceed to upload the part.
objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, rd, partNumber, md5Base64, "", int64(length), opts.ServerSideEncryption, !opts.DisableContentSha256, customHeader) p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: rd, partNumber: partNumber, md5Base64: md5Base64, size: int64(length), sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader}
objPart, uerr := c.uploadPart(ctx, p)
if uerr != nil { if uerr != nil {
return UploadInfo{}, uerr return UploadInfo{}, uerr
} }

View file

@ -24,7 +24,6 @@ import (
"context" "context"
"fmt" "fmt"
"io" "io"
"io/ioutil"
"os" "os"
"strings" "strings"
"sync" "sync"
@ -107,7 +106,7 @@ func (c Client) PutObjectsSnowball(ctx context.Context, bucketName string, opts
return nopReadSeekCloser{bytes.NewReader(b.Bytes())}, int64(b.Len()), nil return nopReadSeekCloser{bytes.NewReader(b.Bytes())}, int64(b.Len()), nil
} }
} else { } else {
f, err := ioutil.TempFile("", "s3-putsnowballobjects-*") f, err := os.CreateTemp("", "s3-putsnowballobjects-*")
if err != nil { if err != nil {
return err return err
} }

View file

@ -166,7 +166,7 @@ func (c *Client) removeObject(ctx context.Context, bucketName, objectName string
headers.Set(amzBucketReplicationStatus, string(opts.Internal.ReplicationStatus)) headers.Set(amzBucketReplicationStatus, string(opts.Internal.ReplicationStatus))
} }
if opts.Internal.ReplicationRequest { if opts.Internal.ReplicationRequest {
headers.Set(minIOBucketReplicationRequest, "") headers.Set(minIOBucketReplicationRequest, "true")
} }
if opts.ForceDelete { if opts.ForceDelete {
headers.Set(minIOForceDelete, "true") headers.Set(minIOForceDelete, "true")

View file

@ -316,17 +316,15 @@ type completeMultipartUploadResult struct {
// CompletePart sub container lists individual part numbers and their // CompletePart sub container lists individual part numbers and their
// md5sum, part of completeMultipartUpload. // md5sum, part of completeMultipartUpload.
type CompletePart struct { type CompletePart struct {
XMLName xml.Name `xml:"http://s3.amazonaws.com/doc/2006-03-01/ Part" json:"-"`
// Part number identifies the part. // Part number identifies the part.
PartNumber int PartNumber int
ETag string ETag string
// Checksum values // Checksum values
ChecksumCRC32 string ChecksumCRC32 string `xml:"ChecksumCRC32,omitempty"`
ChecksumCRC32C string ChecksumCRC32C string `xml:"ChecksumCRC32C,omitempty"`
ChecksumSHA1 string ChecksumSHA1 string `xml:"ChecksumSHA1,omitempty"`
ChecksumSHA256 string ChecksumSHA256 string `xml:"ChecksumSHA256,omitempty"`
} }
// completeMultipartUpload container for completing multipart upload. // completeMultipartUpload container for completing multipart upload.

View file

@ -41,8 +41,8 @@ type CSVFileHeaderInfo string
// Constants for file header info. // Constants for file header info.
const ( const (
CSVFileHeaderInfoNone CSVFileHeaderInfo = "NONE" CSVFileHeaderInfoNone CSVFileHeaderInfo = "NONE"
CSVFileHeaderInfoIgnore = "IGNORE" CSVFileHeaderInfoIgnore CSVFileHeaderInfo = "IGNORE"
CSVFileHeaderInfoUse = "USE" CSVFileHeaderInfoUse CSVFileHeaderInfo = "USE"
) )
// SelectCompressionType - is the parameter for what type of compression is // SelectCompressionType - is the parameter for what type of compression is
@ -52,15 +52,15 @@ type SelectCompressionType string
// Constants for compression types under select API. // Constants for compression types under select API.
const ( const (
SelectCompressionNONE SelectCompressionType = "NONE" SelectCompressionNONE SelectCompressionType = "NONE"
SelectCompressionGZIP = "GZIP" SelectCompressionGZIP SelectCompressionType = "GZIP"
SelectCompressionBZIP = "BZIP2" SelectCompressionBZIP SelectCompressionType = "BZIP2"
// Non-standard compression schemes, supported by MinIO hosts: // Non-standard compression schemes, supported by MinIO hosts:
SelectCompressionZSTD = "ZSTD" // Zstandard compression. SelectCompressionZSTD SelectCompressionType = "ZSTD" // Zstandard compression.
SelectCompressionLZ4 = "LZ4" // LZ4 Stream SelectCompressionLZ4 SelectCompressionType = "LZ4" // LZ4 Stream
SelectCompressionS2 = "S2" // S2 Stream SelectCompressionS2 SelectCompressionType = "S2" // S2 Stream
SelectCompressionSNAPPY = "SNAPPY" // Snappy stream SelectCompressionSNAPPY SelectCompressionType = "SNAPPY" // Snappy stream
) )
// CSVQuoteFields - is the parameter for how CSV fields are quoted. // CSVQuoteFields - is the parameter for how CSV fields are quoted.
@ -69,7 +69,7 @@ type CSVQuoteFields string
// Constants for csv quote styles. // Constants for csv quote styles.
const ( const (
CSVQuoteFieldsAlways CSVQuoteFields = "Always" CSVQuoteFieldsAlways CSVQuoteFields = "Always"
CSVQuoteFieldsAsNeeded = "AsNeeded" CSVQuoteFieldsAsNeeded CSVQuoteFields = "AsNeeded"
) )
// QueryExpressionType - is of what syntax the expression is, this should only // QueryExpressionType - is of what syntax the expression is, this should only
@ -87,7 +87,7 @@ type JSONType string
// Constants for JSONTypes. // Constants for JSONTypes.
const ( const (
JSONDocumentType JSONType = "DOCUMENT" JSONDocumentType JSONType = "DOCUMENT"
JSONLinesType = "LINES" JSONLinesType JSONType = "LINES"
) )
// ParquetInputOptions parquet input specific options // ParquetInputOptions parquet input specific options
@ -378,8 +378,8 @@ type SelectObjectType string
// Constants for input data types. // Constants for input data types.
const ( const (
SelectObjectTypeCSV SelectObjectType = "CSV" SelectObjectTypeCSV SelectObjectType = "CSV"
SelectObjectTypeJSON = "JSON" SelectObjectTypeJSON SelectObjectType = "JSON"
SelectObjectTypeParquet = "Parquet" SelectObjectTypeParquet SelectObjectType = "Parquet"
) )
// preludeInfo is used for keeping track of necessary information from the // preludeInfo is used for keeping track of necessary information from the
@ -416,7 +416,7 @@ type messageType string
const ( const (
errorMsg messageType = "error" errorMsg messageType = "error"
commonMsg = "event" commonMsg messageType = "event"
) )
// eventType represents the type of event. // eventType represents the type of event.
@ -425,9 +425,9 @@ type eventType string
// list of event-types returned by Select API. // list of event-types returned by Select API.
const ( const (
endEvent eventType = "End" endEvent eventType = "End"
recordsEvent = "Records" recordsEvent eventType = "Records"
progressEvent = "Progress" progressEvent eventType = "Progress"
statsEvent = "Stats" statsEvent eventType = "Stats"
) )
// contentType represents content type of event. // contentType represents content type of event.

Some files were not shown because too many files have changed in this diff Show more